Celeribacter indicus: P73_1678 Help Entry P73_1678          CDS       T03575                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cid  Celeribacter indicus Pathway cid01100   Metabolic pathways cid01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cid00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P73_1678 (acpP)    00074 Mycolic acid biosynthesis     P73_1678 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P73_1678 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  AJE46393 UniProt:  A0A0B5DS85 LinkDB All DBs Position 1688533..1688766 Genome browser AA seq 77 aa AA seqDB search MSDIADRVRKIVVEHLDVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISEAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagatcgcgtgagaaagatcgtcgtcgagcatctcgacgttgaagag gacaaggtgaccgaaaacgcatccttcatcgacgatctgggcgccgacagcctcgatacc gtcgaactggtgatggctttcgaagaagaattcggcatcgagattccggacgacgcggcc gagacgatccagaccttcggcgacgcggtgaagttcatctccgaagcctcctga

DBGET integrated database retrieval system