Celeribacter indicus: P73_2638 Help Entry P73_2638          CDS       T03575                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cid  Celeribacter indicus Pathway cid01100   Metabolic pathways cid01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cid00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     P73_2638    00074 Mycolic acid biosynthesis     P73_2638   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     P73_2638 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AJE47353 UniProt:  A0A0B5DVB2 LinkDB All DBs Position complement(2637772..2638038) Genome browser AA seq 88 aa AA seqDB search MAQDVKEKIIGIIAEQAVLEPSDIGMDQSLEELGIDSLGLVESIFAIEEAFDISVPFNAN EPEQSEFDISSVAAIVAAVEGLIADQKA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggcgcaggatgtgaaagagaagatcatcgggatcatcgcggaacaggccgttctcgag ccctccgatatcggcatggaccaatcgctcgaagaactcgggatcgacagtctcggcctt gtggagagcattttcgcaatcgaggaagcctttgacatctctgtgcctttcaacgcgaac gaacctgaacaatcggaattcgacatttcctccgtcgccgccatcgtggcggcggtcgag gggctgatcgcagaccagaaggcatga

DBGET integrated database retrieval system