KEGG   Celeribacter indicus: P73_3415
Entry
P73_3415          CDS       T03575                                 
Name
(GenBank) twin-arginine translocation protein, TatB subunit
  KO
K03117  sec-independent protein translocase protein TatB
Organism
cid  Celeribacter indicus
Pathway
cid03060  Protein export
cid03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cid00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    P73_3415
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    P73_3415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cid02044]
    P73_3415
Secretion system [BR:cid02044]
 Twin-arginine translocation (Tat) system
  Twin-arginine translocation (Tat) pathway protein
   P73_3415
SSDB
Motif
Pfam: TatA_B_E
Other DBs
NCBI-ProteinID: AJE48130
UniProt: A0A0B5E429
LinkDB
Position
complement(3484675..3485397)
AA seq 240 aa
MFFAQMPQLRLFFDIGMSEMLVIGVVALIVVGPKDLPAMFRTLGRFTARAKAMAREFSRA
MEAAADESGLNEASSALKAASNPKKFGLDKLNEAADQFEKWDPMKAADGKPAPKTTQLGK
DEAAPDHADPAAEAEADAADAATGAAQVATNRAEAEAAAGAEVPAAAPATGKAAAKKTAA
KKKTAAKTADAKTSDAKTAAKAATAKTAPARKTPAKTAQARGAAKKATADKPAPKTEGEA
NT seq 723 nt   +upstreamnt  +downstreamnt
atgttcttcgctcagatgccgcagctcaggctgttctttgacatcggcatgtcggaaatg
ctggtgatcggggtggtggccctcatcgtggtcggtccgaaggatctcccggcgatgttc
cgcacgctcgggcgcttcacggcacgggcaaaggcgatggcgcgcgaattttcccgcgcg
atggaggcggcggcggacgagagcggcctcaacgaagcctcgagcgcgctgaaggccgcc
tccaatccgaagaaattcggcctcgacaagctcaacgaggcggccgaccagttcgagaaa
tgggacccgatgaaggcggcggacggaaagccggcgccgaagacgacgcagctcggcaag
gacgaggccgcgcccgaccacgcggatcccgccgcggaggccgaggcggatgcggcggat
gcggccacgggcgcagcgcaggtggcgacgaaccgtgcggaggccgaggcggcggccggg
gcggaggtgcccgccgccgcacccgcgaccggcaaggccgcggcgaagaagaccgccgcg
aagaagaagaccgccgcgaagacggcggatgcgaaaacatccgatgcgaagacggcggcg
aaggccgcgaccgcgaagacggcgccggccaggaagacccccgcgaagacggcgcaggcc
aggggcgcggcaaagaaggccacggcggacaaaccggcgccgaagacggaaggtgaggca
tga

DBGET integrated database retrieval system