Celeribacter indicus: P73_4029 Help Entry P73_4029          CDS       T03575                                  Name (GenBank) ribose-5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism cid  Celeribacter indicus Pathway cid00030   Pentose phosphate pathway cid00051   Fructose and mannose metabolism cid00710   Carbon fixation by Calvin cycle cid01100   Metabolic pathways cid01110   Biosynthesis of secondary metabolites cid01120   Microbial metabolism in diverse environments cid01200   Carbon metabolism cid01230   Biosynthesis of amino acids Module cid_M00004   Pentose phosphate pathway (Pentose phosphate cycle) cid_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:cid00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     P73_4029    00051 Fructose and mannose metabolism     P73_4029   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     P73_4029 Enzymes [BR:cid01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      P73_4029 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB MotA_N Motif Other DBs NCBI-ProteinID:  AJE48744 UniProt:  A0A0B5E0G9 LinkDB All DBs Position 4139189..4139632 Genome browser AA seq 147 aa AA seqDB search MRIAIGCDHAGFPAKHTVLEILNSLGMEPRDCGTDSTEPVDFPVMTRKVCQLVTGGEADR ALLICGTGVGAVMAANRIRGIRAFVGHDAYSAAQGVEHDNANVMCLGAWIVGPAVMRHSI TAFLAAEFSTEEHFRRRVAMLSAMEHD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgcgtatcgcgatcggttgtgaccacgccgggtttccggcaaagcatacggtcctcgag atcctgaactcgctcggcatggagccgagggattgcggaaccgacagcacggagcccgtc gacttccccgtcatgacccgcaaggtatgtcagcttgtgactggaggcgaggccgatcgt gcgctgctgatctgcggcaccggcgtcggcgcggtcatggccgccaaccgcatccgcggc atccgcgccttcgtcggccatgatgcctattctgcggcgcaaggcgtcgagcatgataac gccaatgtgatgtgcctcggcgcctggattgtcggcccagctgtcatgcggcactcgatc acggcgtttctcgcagccgaattcagcaccgaagagcattttcgccgccgcgtggcgatg ttgtctgccatggaacacgactga

DBGET integrated database retrieval system