Ctenopharyngodon idella (grass carp): 127495264 Help Entry 127495264         CDS       T08802                                  Name (RefSeq) dynein, light chain, LC8-type 2a   KO K10418   dynein light chain LC8-type Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04145   Phagocytosis cide04517   IgSF CAM signaling cide04814   Motor proteins cide05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     127495264  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     127495264   09142 Cell motility    04814 Motor proteins     127495264  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127495264  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cide03037]     127495264    04812 Cytoskeleton proteins [BR:cide04812]     127495264 Cilium and associated proteins [BR:cide03037]  Motile cilia and associated proteins   Dynein arm    127495264 Cytoskeleton proteins [BR:cide04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      127495264 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Nop SpoIIIAH Ectatomin Motif Other DBs NCBI-GeneID:  127495264 NCBI-ProteinID:  XP_051717926 LinkDB All DBs Position 15 Genome browser AA seq 89 aa AA seqDB search MTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaccgacaggaaggctgtgatcaagaacgccgacatgtctgaagacatgcagcaggat gcggtggactgtgctacacaggccatggagaaatacaacatagagaaggacattgccgca tacatcaaaaaggagttcgataagaaatacaatcctacgtggcattgcattgtgggaagg aacttcggcagctacgtgacccatgagacaaaacacttcatctacttctacttgggccag gtggccattctcctcttcaagtctggctga

DBGET integrated database retrieval system