Ctenopharyngodon idella (grass carp): 127497067 Help Entry 127497067         CDS       T08802                                  Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04010   MAPK signaling pathway cide04144   Endocytosis cide04370   VEGF signaling pathway cide04510   Focal adhesion cide04517   IgSF CAM signaling cide04520   Adherens junction cide04530   Tight junction cide04810   Regulation of actin cytoskeleton cide04912   GnRH signaling pathway cide05100   Bacterial invasion of epithelial cells cide05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127497067    04370 VEGF signaling pathway     127497067   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     127497067  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127497067   09144 Cellular community - eukaryotes    04510 Focal adhesion     127497067    04520 Adherens junction     127497067    04530 Tight junction     127497067   09142 Cell motility    04810 Regulation of actin cytoskeleton     127497067  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     127497067  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127497067    05100 Bacterial invasion of epithelial cells     127497067  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cide04131]     127497067    03036 Chromosome and associated proteins [BR:cide03036]     127497067   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cide04147]     127497067    04031 GTP-binding proteins [BR:cide04031]     127497067 Membrane trafficking [BR:cide04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     127497067  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     127497067   Macropinocytosis    Ras GTPases     127497067 Chromosome and associated proteins [BR:cide03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     127497067 Exosome [BR:cide04147]  Exosomal proteins   Exosomal proteins of microglial cells    127497067   Exosomal proteins of breast milk    127497067 GTP-binding proteins [BR:cide04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     127497067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  127497067 NCBI-ProteinID:  XP_051721178 LinkDB All DBs Position 16:21990237..22000131 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR DDSNTVEKLAKNKQRPISPESGEKLARDLRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKPKKRCILL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagaccataaagtgtgtggtggttggagatggagctgtcggaaagacctgcctcctc atctcatacacaaccaacaaattcccctctgaatatgttcccacggtgtttgataattat gctgtcacagtgatgatcggaggggaaccatatacactggggctttttgacacagcaggt caggaagactacgacagacttcggcctctcagttatccgcagacagacgtcttccttgtt tgcttctctgttgtctctccttcctcctttgagaatgtgaaagagaagtgggtaccagag atctctcaccactgtccacgcactccattccttcttgtgggcactcaggttgacctgagg gatgacagtaacactgtggaaaaacttgccaaaaacaagcagcggcccatatcgcctgag agtggtgagaagctggccagagacctcagagctgtcaaatacgtggagtgctccgccctc acacagagaggcctgaagaatgtattcgatgaggcgatacttgctgcccttgaacctccg gagaccaaacccaagaagcgctgcatccttttgtag

DBGET integrated database retrieval system