Ctenopharyngodon idella (grass carp): 127497669 Help Entry 127497669         CDS       T08802                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04068   FoxO signaling pathway cide04136   Autophagy - other cide04140   Autophagy - animal cide04621   NOD-like receptor signaling pathway cide04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     127497669  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127497669    04136 Autophagy - other     127497669  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cide04131]     127497669    04121 Ubiquitin system [BR:cide04121]     127497669    03029 Mitochondrial biogenesis [BR:cide03029]     127497669 Membrane trafficking [BR:cide04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     127497669 Ubiquitin system [BR:cide04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    127497669 Mitochondrial biogenesis [BR:cide03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     127497669 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  127497669 NCBI-ProteinID:  XP_051722284 LinkDB All DBs Position 16:complement(14539766..14543143) Genome browser AA seq 120 aa AA seqDB search MSDNAESPTENQKDEPSVQHTVTEHTGSSDEKKKIDVLLKAVGDTPIMKTKKWSVERGRT VQSLSQFISRFLKLEPSEQLFIYVNQSFAPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagaatctcctacagaaaatcaaaaagatgaaccttcggtacaacac actgtcactgaacacactggatcatcggatgagaagaaaaagattgatgtgctgttgaag gctgtcggtgatacgcccatcatgaagaccaaaaaatggtccgtggagagagggaggaca gtgcagtcactctctcaattcatctcacgctttctcaaattggagcctagtgaacaactg ttcatttatgtcaatcagtcatttgctccatcaccagaccaagaagtgggtgtgcttttt gagtgttttgggagtgatgggaaactagttctccattactgcaagtcccaggcctgggga tga

DBGET integrated database retrieval system