Ctenopharyngodon idella (grass carp): 127498906 Help Entry 127498906         CDS       T08802                                  Name (RefSeq) mitoregulin-like   KO K29035   mitoregulin Organism cide  Ctenopharyngodon idella (grass carp) Brite KEGG Orthology (KO) [BR:cide00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cide03029]     127498906 Mitochondrial biogenesis [BR:cide03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Other regulator of mitochondrial biogenesis     127498906 SSDB OrthologParalogGFIT Motif Pfam:  MTLN LapA_dom SPC12 Motif Other DBs NCBI-GeneID:  127498906 NCBI-ProteinID:  XP_051724822 LinkDB All DBs Position 17 Genome browser AA seq 56 aa AA seqDB search MADVSERTLQVAIVVSFAAGFVAGWQANRMRRKFLDWRKKRLQDKLAETQKKLDLS NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atggcggatgtgtcggagaggacgttacaggttgctatagtcgtttcgtttgcggcgggt tttgtcgcaggctggcaggcaaacagaatgcgaagaaagttcttggactggcggaaaaag cggttacaggacaaactcgcagaaacacagaagaagctagacctgtcatga

DBGET integrated database retrieval system