Ctenopharyngodon idella (grass carp): 127499443 Help Entry 127499443         CDS       T08802                                  Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism cide  Ctenopharyngodon idella (grass carp) Brite KEGG Orthology (KO) [BR:cide00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cide03019]     127499443    03029 Mitochondrial biogenesis [BR:cide03029]     127499443 Messenger RNA biogenesis [BR:cide03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      127499443 Mitochondrial biogenesis [BR:cide03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     127499443 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  127499443 NCBI-ProteinID:  XP_051725705 UniProt:  M4MC12 LinkDB All DBs Position 18:complement(24052585..24053458) Genome browser AA seq 60 aa AA seqDB search MDPCDCAKTGTCNCGATCKCTNCQCTTCKKSCCPCCPSGCSKCASGCVCKGNSCGSSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgcgactgcgccaagactggaacttgcaactgtggtgccacctgcaagtgc actaactgccagtgtacaacctgcaagaagagttgttgtccctgctgcccgtctggttgc agcaaatgtgcctctggctgcgtctgtaagggcaattcctgcggctccagctgctgtcaa tga

DBGET integrated database retrieval system