Ctenopharyngodon idella (grass carp): 127500825 Help Entry 127500825         CDS       T08802                                  Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04382   Cornified envelope formation cide05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cide00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     127500825  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127500825  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cide04147]     127500825 Exosome [BR:cide04147]  Exosomal proteins   Exosomal proteins of microglial cells    127500825 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  127500825 NCBI-ProteinID:  XP_051728319 LinkDB All DBs Position 19:complement(12183464..12184535) Genome browser AA seq 102 aa AA seqDB search MPSELETAMESLIMVFHRYAGKEGRSGTLTRRELRTLMENELSGFLKSQKDPTTIDRIMK DLDANGDGEVNFEEFVSLVVGLSIACEACYRMQLKNTQSWNL NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgccttccgaactagagactgccatggagtccctcatcatggtattccaccggtacgct ggaaaagagggcaggagcggcaccctgacccgccgtgaactccgaaccctgatggagaac gagctctctgggtttctcaagtctcagaaggatccaaccaccatagacagaattatgaag gacttggatgccaatggggatggagaagtgaactttgaggagtttgtgtctttggttgtg ggtttgtccatcgcctgtgaggcttgctacaggatgcagttaaagaacacacaaagctgg aacctatga

DBGET integrated database retrieval system