Ctenopharyngodon idella (grass carp): 127504117
Help
Entry
127504117 CDS
T08802
Name
(RefSeq) fibroblast growth factor 1b
KO
K18496
fibroblast growth factor 1
Organism
cide
Ctenopharyngodon idella (grass carp)
Pathway
cide04010
MAPK signaling pathway
cide04020
Calcium signaling pathway
cide04810
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:
cide00001
]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
127504117
04020 Calcium signaling pathway
127504117
09140 Cellular Processes
09142 Cell motility
04810 Regulation of actin cytoskeleton
127504117
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
cide04052
]
127504117
00536 Glycosaminoglycan binding proteins [BR:
cide00536
]
127504117
Cytokines and neuropeptides [BR:
cide04052
]
Cytokines
Growth factors (RTK binding)
127504117
Glycosaminoglycan binding proteins [BR:
cide00536
]
Heparan sulfate / Heparin
Growth factors/receptors
127504117
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FGF
Fascin
Motif
Other DBs
NCBI-GeneID:
127504117
NCBI-ProteinID:
XP_051734520
LinkDB
All DBs
Position
21:26220661..26223032
Genome browser
AA seq
158 aa
AA seq
DB search
MTERDITAFTLLPTTTVQKDPKHNSLQKLYCRNGGYHLRIQPNGTVDASRQDNDVYTLLK
VKAVKAGLVAIRGHETGLYLAMDKCGKLYGTAMLNDECYFIEKIEENHYNTYRSQRYQEN
GDWYVGIKKNGWTKNGSKTHKGQNAIYFLPIPVDGSMQ
NT seq
477 nt
NT seq
+upstream
nt +downstream
nt
atgaccgagcgggatatcaccgctttcacactgctaccgacgaccaccgtccagaaagat
ccaaaacacaattccctgcaaaaactctactgcaggaatggaggataccatctccggatc
caacccaacgggactgtggacgcgagtcgacaagataacgacgtttacactcttttgaag
gtaaaagctgtgaaagcaggattggtggccatcaggggtcatgagactggactatacctg
gcaatggataaatgtggaaaactttatggcactgccatgctgaacgacgagtgttacttc
attgagaagatagaggagaaccactacaacacataccgttcacagaggtatcaggagaat
ggagactggtacgtggggatcaaaaagaacggatggacaaaaaacggctccaaaacgcac
aagggccaaaatgcaatctacttcctgccaattccagtggatggcagcatgcagtaa
DBGET
integrated database retrieval system