Ctenopharyngodon idella (grass carp): 127507367 Help Entry 127507367         CDS       T08802                                  Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04010   MAPK signaling pathway cide04012   ErbB signaling pathway cide04068   FoxO signaling pathway cide04137   Mitophagy - animal cide04140   Autophagy - animal cide04144   Endocytosis cide04150   mTOR signaling pathway cide04210   Apoptosis cide04218   Cellular senescence cide04370   VEGF signaling pathway cide04371   Apelin signaling pathway cide04510   Focal adhesion cide04540   Gap junction cide04625   C-type lectin receptor signaling pathway cide04810   Regulation of actin cytoskeleton cide04910   Insulin signaling pathway cide04912   GnRH signaling pathway cide04916   Melanogenesis cide05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127507367    04012 ErbB signaling pathway     127507367    04370 VEGF signaling pathway     127507367    04371 Apelin signaling pathway     127507367    04068 FoxO signaling pathway     127507367    04150 mTOR signaling pathway     127507367  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127507367    04140 Autophagy - animal     127507367    04137 Mitophagy - animal     127507367   09143 Cell growth and death    04210 Apoptosis     127507367    04218 Cellular senescence     127507367   09144 Cellular community - eukaryotes    04510 Focal adhesion     127507367    04540 Gap junction     127507367   09142 Cell motility    04810 Regulation of actin cytoskeleton     127507367  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127507367   09152 Endocrine system    04910 Insulin signaling pathway     127507367    04912 GnRH signaling pathway     127507367    04916 Melanogenesis     127507367  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127507367  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cide04131]     127507367   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cide04147]     127507367    04031 GTP-binding proteins [BR:cide04031]     127507367 Membrane trafficking [BR:cide04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127507367  Endocytosis   Macropinocytosis    Ras GTPases     127507367 Exosome [BR:cide04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127507367   Exosomal proteins of colorectal cancer cells    127507367 GTP-binding proteins [BR:cide04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127507367 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  127507367 NCBI-ProteinID:  XP_051740366 LinkDB All DBs Position 24:21431005..21463161 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaactggtggtggtgggtgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgaccctactatagaggactcctac aggaagcaggtggtgattgacggggagacatgtctactggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggcgagggattcctttgt gtctttgccatcaataacaccaagtcctttgaggacattcaccaatacagggaacaaatc aaacgggtaaaggactccgatgacgtgcccatggtgctggtgggtaacaaatgtgacctc ccggctcggacggtggacacacggcaagcacaggagctcgcccgcagttacgggatccct ttcatcgagacctcagccaaaaccagacaaggtgtggaggacgcgttttacacgctcgta cgagagatccgtcaacacaaaatgaggaagctgaacccaccggatgagagtggacaggac tgcatgagctgccgctgcgttgtgtcgtga

DBGET integrated database retrieval system