Ctenopharyngodon idella (grass carp): 127507367 Help Entry 127507367         CDS       T08802                                  Name (RefSeq) HRas proto-oncogene, GTPase a   KO K02833   GTPase HRas Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04010   MAPK signaling pathway cide04012   ErbB signaling pathway cide04068   FoxO signaling pathway cide04137   Mitophagy - animal cide04140   Autophagy - animal cide04144   Endocytosis cide04150   mTOR signaling pathway cide04210   Apoptosis cide04218   Cellular senescence cide04370   VEGF signaling pathway cide04371   Apelin signaling pathway cide04510   Focal adhesion cide04540   Gap junction cide04625   C-type lectin receptor signaling pathway cide04810   Regulation of actin cytoskeleton cide04910   Insulin signaling pathway cide04912   GnRH signaling pathway cide04916   Melanogenesis cide05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     127507367    04150 mTOR signaling pathway     127507367  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127507367    04140 Autophagy - animal     127507367    04137 Mitophagy - animal     127507367  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cide04131]     127507367   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cide04147]     127507367    04031 GTP-binding proteins [BR:cide04031]     127507367 Membrane trafficking [BR:cide04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127507367  Endocytosis   Macropinocytosis    Ras GTPases     127507367 Exosome [BR:cide04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    127507367   Exosomal proteins of colorectal cancer cells    127507367 GTP-binding proteins [BR:cide04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127507367 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  127507367 NCBI-ProteinID:  XP_051740366 LinkDB All DBs Position 24:21431005..21463161 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaactggtggtggtgggtgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgaccctactatagaggactcctac aggaagcaggtggtgattgacggggagacatgtctactggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggcgagggattcctttgt gtctttgccatcaataacaccaagtcctttgaggacattcaccaatacagggaacaaatc aaacgggtaaaggactccgatgacgtgcccatggtgctggtgggtaacaaatgtgacctc ccggctcggacggtggacacacggcaagcacaggagctcgcccgcagttacgggatccct ttcatcgagacctcagccaaaaccagacaaggtgtggaggacgcgttttacacgctcgta cgagagatccgtcaacacaaaatgaggaagctgaacccaccggatgagagtggacaggac tgcatgagctgccgctgcgttgtgtcgtga

DBGET integrated database retrieval system