Ctenopharyngodon idella (grass carp): 127507742 Help Entry 127507742         CDS       T08802                                  Name (RefSeq) histone H2B-like   KO K11252   histone H2B Organism cide  Ctenopharyngodon idella (grass carp) Brite KEGG Orthology (KO) [BR:cide00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:cide03036]     127507742   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cide04147]     127507742 Chromosome and associated proteins [BR:cide03036]  Eukaryotic type   Nucleosome assembly factors    Histones     127507742 Exosome [BR:cide04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127507742 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  127507742 NCBI-ProteinID:  XP_051740996 LinkDB All DBs Position 24:complement(26345673..26346049) Genome browser AA seq 80 aa AA seqDB search MPEPAKSAPKKGSKKAVTKTAGKGGKKRKRSRKESYAIYVYKVLEAERSRPPCVCCLPGE LAKHAVSEGTKAVTKYTSSK NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccagcaaagtctgcgcctaagaagggctccaagaaggccgtcacgaagacc gccggtaagggaggaaagaagcgcaagaggtccaggaaggagagttacgctatctacgtc tacaaagtccttgaagcagagagatccagaccgccgtgcgtctgctgcttgcccggagag ctggccaaacacgccgtgtccgagggcaccaaggcagtgaccaagtacaccagctccaag tag

DBGET integrated database retrieval system