Ctenopharyngodon idella (grass carp): 127508035 Help Entry 127508035         CDS       T08802                                  Name (RefSeq) insulin   KO K04526   insulin Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04010   MAPK signaling pathway cide04068   FoxO signaling pathway cide04081   Hormone signaling cide04114   Oocyte meiosis cide04140   Autophagy - animal cide04150   mTOR signaling pathway cide04810   Regulation of actin cytoskeleton cide04910   Insulin signaling pathway cide04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     127508035    04150 mTOR signaling pathway     127508035   09133 Signaling molecules and interaction    04081 Hormone signaling     127508035  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127508035  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cide04052]     127508035 Cytokines and neuropeptides [BR:cide04052]  Neuropeptides   Unclassified    127508035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  127508035 NCBI-ProteinID:  XP_051741496 LinkDB All DBs Position 3:29807538..29809178 Genome browser AA seq 111 aa AA seqDB search MHRSGLLLLLSLCAGSLVTRSGAFGNRKLCGIQLVEALLLVCGEKGLFYQPGRRFSFRIM RNSAPFLRQTGVAAQSGERGTARSSVAKRGIVEQCCHFYCDYYDLENYCNT NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgcacagatctggattgctcctgctgctgtctctgtgtgccggctctctggtgacccgt agtggcgcgtttgggaatcgaaagctgtgcgggattcagcttgtggaagcgctgctactt gtctgtggtgaaaagggtctcttctaccagcctggcaggcgtttcagtttccgcatcatg aggaacagcgcccccttcctgcggcagacgggagtggctgctcagagtggagagaggggc actgccagaagcagtgttgcaaagagaggcattgtagagcagtgctgccatttctactgt gactattatgacctggagaattactgtaacacatag

DBGET integrated database retrieval system