Ctenopharyngodon idella (grass carp): 127509811 Help Entry 127509811         CDS       T08802                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cide00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     127509811  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cide04121]     127509811    03400 DNA repair and recombination proteins [BR:cide03400]     127509811 Ubiquitin system [BR:cide04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      127509811    Cul5 complex      127509811 DNA repair and recombination proteins [BR:cide03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      127509811 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Motif Other DBs NCBI-GeneID:  127509811 NCBI-ProteinID:  XP_051744769 LinkDB All DBs Position 3 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRAPEDQRLYKEDMLLEDSKTLGDC GFTNQTARPQAPATVGLAFRISDDAFEPLRIEAFSSPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtctttttgatgatcagacgtcacaagacaaccatcttcacggatgctaaggag tctaccacagtctacgagctgaagcggattgtggagggcatcctaaagcgagcaccagag gatcagaggctttataaggaggacatgctgctagaagatagtaagactctcggagactgt ggcttcacaaaccagacagccaggcctcaggctccggccacagtaggactggcttttcgc atcagtgatgatgcttttgagcctctgagaatagaggccttctccagccctcctgagctt cctgatgttatgaagcctcaagactcgggcagcaccgccaacgaacaagccgtgcagtga

DBGET integrated database retrieval system