Ctenopharyngodon idella (grass carp): 127514981 Help Entry 127514981         CDS       T08802                                  Name (RefSeq) ras homolog family member Ca   KO K04513   Ras homolog gene family, member A Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04081   Hormone signaling cide04144   Endocytosis cide04150   mTOR signaling pathway cide04270   Vascular smooth muscle contraction cide04310   Wnt signaling pathway cide04350   TGF-beta signaling pathway cide04510   Focal adhesion cide04520   Adherens junction cide04530   Tight junction cide04621   NOD-like receptor signaling pathway cide04625   C-type lectin receptor signaling pathway cide04810   Regulation of actin cytoskeleton cide05100   Bacterial invasion of epithelial cells cide05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     127514981    04350 TGF-beta signaling pathway     127514981    04150 mTOR signaling pathway     127514981   09133 Signaling molecules and interaction    04081 Hormone signaling     127514981  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127514981   09144 Cellular community - eukaryotes    04510 Focal adhesion     127514981    04520 Adherens junction     127514981    04530 Tight junction     127514981   09142 Cell motility    04810 Regulation of actin cytoskeleton     127514981  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     127514981    04625 C-type lectin receptor signaling pathway     127514981   09153 Circulatory system    04270 Vascular smooth muscle contraction     127514981  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127514981    05100 Bacterial invasion of epithelial cells     127514981  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cide04131]     127514981   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cide04147]     127514981    04031 GTP-binding proteins [BR:cide04031]     127514981 Membrane trafficking [BR:cide04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     127514981 Exosome [BR:cide04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127514981   Exosomal proteins of other body fluids (saliva and urine)    127514981   Exosomal proteins of colorectal cancer cells    127514981   Exosomal proteins of bladder cancer cells    127514981 GTP-binding proteins [BR:cide04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     127514981 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  127514981 NCBI-ProteinID:  XP_051754238 LinkDB All DBs Position 6:complement(28805635..28823689) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDSKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELTKMKQEPVKPEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAALQ VRKRKKRSGCLLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgctatcaggaaaaagctggtgatcgtgggagatggagcttgtgggaagacctgt ctactcatagtgttcagcaaagatcagtttccagaagtctacgtgcctactgtgttcgag aactacattgcagacatcgaagttgacagcaaacaggtggagctcgctttgtgggacaca gcaggacaggaagactatgatcgcctgagacctctgtcttacccagacacagatgtcatc ctcatgtgtttctccatagacagtcccgacagtttagagaatatcccagaaaagtggacg cctgaggtgaagcacttctgccccaacgttcccataatcctcgtgggcaataagaaggat ctgcggaatgatgagcacacacggagagagctgactaagatgaagcaggagccggttaaa ccagaggagggcagagacatggccaaccgtattagcgcctttggctacctagaatgctca gccaagactaaggagggtgtgagggaagtattcgaaatggccaccagggcggcgctgcaa gtccgcaaaaggaagaagagaagcgggtgcttgctgttgtaa

DBGET integrated database retrieval system