Ctenopharyngodon idella (grass carp): 127516705 Help Entry 127516705         CDS       T08802                                  Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04060   Cytokine-cytokine receptor interaction cide04218   Cellular senescence cide04620   Toll-like receptor signaling pathway cide04621   NOD-like receptor signaling pathway cide04622   RIG-I-like receptor signaling pathway cide05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127516705  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     127516705  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     127516705    04621 NOD-like receptor signaling pathway     127516705    04622 RIG-I-like receptor signaling pathway     127516705  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     127516705  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cide04052]     127516705    00536 Glycosaminoglycan binding proteins [BR:cide00536]     127516705 Cytokines and neuropeptides [BR:cide04052]  Cytokines   Chemokines    127516705 Glycosaminoglycan binding proteins [BR:cide00536]  Heparan sulfate / Heparin   Chemokines    127516705 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Hemotin Motif Other DBs NCBI-GeneID:  127516705 NCBI-ProteinID:  XP_051757495 LinkDB All DBs Position 7 Genome browser AA seq 99 aa AA seqDB search MNVFLMLTVIGASIVLFGAVQPHSAGYNTRCMCLKLESRIIPPDNLRRVEILPRGPHCKT TEVIAGLSSGERICLNPRTPWVKKLILFIEKKERAAKKA NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaacgtcttcctgatgttaaccgttattggagccagcatcgttctgttcggtgctgtg cagcctcacagcgcaggttacaacacccgctgcatgtgtctgaaactggagtccaggatc atcccacctgacaacctgcggcgggtggagatcctgcctagaggccctcactgcaagact actgaggttattgctggtttatcaagtggagaaaggatctgtctaaaccccaggacacca tgggttaaaaaactcattctctttattgagaaaaaagagcgagcagccaagaaagcctag

DBGET integrated database retrieval system