Ctenopharyngodon idella (grass carp): 127517208 Help Entry 127517208         CDS       T08802                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04010   MAPK signaling pathway cide04012   ErbB signaling pathway cide04068   FoxO signaling pathway cide04137   Mitophagy - animal cide04140   Autophagy - animal cide04150   mTOR signaling pathway cide04210   Apoptosis cide04218   Cellular senescence cide04370   VEGF signaling pathway cide04371   Apelin signaling pathway cide04540   Gap junction cide04625   C-type lectin receptor signaling pathway cide04810   Regulation of actin cytoskeleton cide04910   Insulin signaling pathway cide04912   GnRH signaling pathway cide04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     127517208    04012 ErbB signaling pathway     127517208    04370 VEGF signaling pathway     127517208    04371 Apelin signaling pathway     127517208    04068 FoxO signaling pathway     127517208    04150 mTOR signaling pathway     127517208  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127517208    04137 Mitophagy - animal     127517208   09143 Cell growth and death    04210 Apoptosis     127517208    04218 Cellular senescence     127517208   09144 Cellular community - eukaryotes    04540 Gap junction     127517208   09142 Cell motility    04810 Regulation of actin cytoskeleton     127517208  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     127517208   09152 Endocrine system    04910 Insulin signaling pathway     127517208    04912 GnRH signaling pathway     127517208    04916 Melanogenesis     127517208  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cide04131]     127517208   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cide04147]     127517208    04031 GTP-binding proteins [BR:cide04031]     127517208 Membrane trafficking [BR:cide04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     127517208  Endocytosis   Macropinocytosis    Ras GTPases     127517208 Exosome [BR:cide04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127517208   Exosomal proteins of other body fluids (saliva and urine)    127517208   Exosomal proteins of breast cancer cells    127517208   Exosomal proteins of colorectal cancer cells    127517208 GTP-binding proteins [BR:cide04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     127517208 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 ATP_bind_1 FeoB_N Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  127517208 NCBI-ProteinID:  XP_051758473 LinkDB All DBs Position 8:28400265..28409876 Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagttggttgttgtgggagcaggtggtgtcgggaagagcgcattaacc atccaactcattcagaatcactttgtggatgaatatgaccccactattgaggactcttac aggaagcaggtggtgattgatggtgagacgtgtctgttggacatcctggacactgcaggt caggaagaatacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt gtcttcgctataaacaacagcaaatcctttgcagacgtgcatttgtacagagagcagatc aagcgcgtgaaggattcagacgatgttcccatggtcctagtggggaacaaatgtgatttg gccagaacagtggacaccaagcaagctcaggaacttgccagaagctacggcatagagttt gtagaaacttctgcaaagaccagacagggagttgaggatgctttttacaccctcgtccgt gagatccggcattatcgcatgaaaaagctcaacagcagagaagataggaagcagggctgc ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system