Ctenopharyngodon idella (grass carp): 127518372 Help Entry 127518372         CDS       T08802                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism cide  Ctenopharyngodon idella (grass carp) Brite KEGG Orthology (KO) [BR:cide00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:cide03041]     127518372   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cide04052]     127518372 Spliceosome [BR:cide03041]  Complex B   Other components    Complex B specific factors     127518372 Cytokines and neuropeptides [BR:cide04052]  Neuropeptides   Unclassified    127518372 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Motif Other DBs NCBI-GeneID:  127518372 NCBI-ProteinID:  XP_051760920 LinkDB All DBs Position 1:complement(3572765..3582117) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNQEDKIGDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVTLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggtggtgtgtaacgaccgtttggggaagaaggttcgagtcaaatgcaatcag gaggacaagatcggagacctgaagaagctgatcgcggctcagacgggcacgcgctgggac aagatcgtgctcaagaaatggtacaccatattcaaggaccacgtgacactgggagactat gaaatccatgacggcatgaacctggagctgtattaccagtag

DBGET integrated database retrieval system