Ctenopharyngodon idella (grass carp): 127522935 Help Entry 127522935         CDS       T08802                                  Name (RefSeq) C-C motif chemokine 21-like   KO K13072   C-C motif chemokine 25 Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide04060   Cytokine-cytokine receptor interaction cide04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:cide00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     127522935  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     127522935  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cide04052]     127522935 Cytokines and neuropeptides [BR:cide04052]  Cytokines   Chemokines    127522935 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  127522935 NCBI-ProteinID:  XP_051769264 LinkDB All DBs Position 11:14807403..14809916 Genome browser AA seq 102 aa AA seqDB search METQHSAMKFQILVLILLLACMYPSVAQGSPYENCCLKYIVGVRKNMRRNIVSYRVQETD GGCNIPAIVFKLKKQRTLCADPKQSWVQELMQKIDKKNTGTK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggaaacacagcattcagccatgaagtttcaaattctggttttgatcctgctgttggct tgcatgtatcccagtgtcgcacaaggttctccctatgaaaactgctgtttgaagtacatt gtaggagtgaggaagaacatgagaagaaatattgtgagttatagagtgcaggaaacagat ggagggtgcaacattcctgctattgttttcaagctgaagaagcaaaggacgctctgtgct gatccgaaacaatcctgggtgcaagaactcatgcagaaaatagacaagaaaaacacaggc actaagtag

DBGET integrated database retrieval system