Ctenopharyngodon idella (grass carp): 5857714 Help Entry 5857714           CDS       T08802                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism cide  Ctenopharyngodon idella (grass carp) Pathway cide00190   Oxidative phosphorylation cide01100   Metabolic pathways Module cide_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:cide00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     5857714 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cide03029]     5857714 (ND4L) Enzymes [BR:cide01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      5857714 (ND4L) Mitochondrial biogenesis [BR:cide03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     5857714 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  5857714 NCBI-ProteinID:  YP_001654974 UniProt:  Q7J4F1 LinkDB All DBs Position MT:10090..10386 Genome browser AA seq 98 aa AA seqDB search MTPVHFSFSSAFILGLMGLAFHRTHLLSALLCLEGMMLSLFIALALWALQFESTSFSAAP MLLLAFSACEASTGLALLVATARTHGTDRLQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacaccagtacattttagctttagctcagcattcatcttaggactaatgggattagca ttccatcgcacccatttactctccgcacttctctgcttggagggaataatactatcccta tttattgcattagccctatgggctttacagtttgaatcaacaagcttctccgcagcccca atattgttactagctttctccgcctgcgaagcaagtacgggcctcgcactcctagtagcc acagcccgaacccacggaaccgaccgcctacaaaaccttaatctcctgcaatgttaa

DBGET integrated database retrieval system