Citrobacter sp. CRE-46: AN232_28045 Help Entry AN232_28045       CDS       T05520                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism cie  Citrobacter sp. CRE-46 Brite KEGG Orthology (KO) [BR:cie00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cie03032]     AN232_28045    03036 Chromosome and associated proteins [BR:cie03036]     AN232_28045    03400 DNA repair and recombination proteins [BR:cie03400]     AN232_28045 DNA replication proteins [BR:cie03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AN232_28045 Chromosome and associated proteins [BR:cie03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AN232_28045 DNA repair and recombination proteins [BR:cie03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AN232_28045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  AWS98998 UniProt:  A0A2Z3XDI8 LinkDB All DBs Position unnamed2:complement(11750..12022) Genome browser AA seq 90 aa AA seqDB search MNKSELIMKVAEDADISKAKAEAAVNALINSVKEVLKAGGTVALTGFGTFHVKERAARTG RNPQTGENIQIAAANIPGFKAGKGLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaagcgaactgattatgaaagtggccgaagacgctgatattagcaaagcaaag gccgaagctgcggtaaatgcgctgatcaactcagtgaaagaggtgcttaaagcgggtggg acagtagcgcttactgggtttggtactttccacgttaaggaacgcgcagcgcgaaccgga cggaatccccagactggagagaacatccagatcgcggcggccaacattcctgggttcaaa gctggtaaggggttgaaagactccgtgaactag

DBGET integrated database retrieval system