Citrobacter sp. FDAARGOS_156: AL515_06910 Help Entry AL515_06910       CDS       T04313                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism cif  Citrobacter sp. FDAARGOS_156 Brite KEGG Orthology (KO) [BR:cif00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cif03032]     AL515_06910    03036 Chromosome and associated proteins [BR:cif03036]     AL515_06910    03400 DNA repair and recombination proteins [BR:cif03400]     AL515_06910 DNA replication proteins [BR:cif03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AL515_06910 Chromosome and associated proteins [BR:cif03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AL515_06910 DNA repair and recombination proteins [BR:cif03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AL515_06910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AMH13602 UniProt:  A0A9Q2KIB8 LinkDB All DBs Position 1492420..1492692 Genome browser AA seq 90 aa AA seqDB search MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALVGFGTFAVKERAARTG RNPQTGKEITIAAAKVPGFRAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataaatctcaactgatcgacaaaattgctgcaggggctgatatctctaaagctgcg gctggacgtgcgttagatgcaattattgcttctgttaccgaatccctgaaagaaggtgat gacgtagcactggtaggttttggtacttttgccgttaaagagcgtgctgcccgtactggt cgcaacccgcaaacaggtaaagagatcaccatcgccgcggctaaagtaccgggattccgt gcaggtaaagcactgaaagacgcggtaaactaa

DBGET integrated database retrieval system