Citrobacter sp. FDAARGOS_156: AL515_22030 Help Entry AL515_22030       CDS       T04313                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cif  Citrobacter sp. FDAARGOS_156 Pathway cif01100   Metabolic pathways cif01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cif00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL515_22030    00074 Mycolic acid biosynthesis     AL515_22030   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL515_22030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AMH16378 UniProt:  A0A9Q2KJN2 LinkDB All DBs Position 4686667..4686924 Genome browser AA seq 85 aa AA seqDB search MQALYLEIKNLIITTLNLDELTADDIDTEAALFGDGLGLDSIDALELGLAVKNEYGVVLS AESEEMRQHFFSVATLASFIHAQRA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgctttatcttgaaatcaaaaatctcattataacgacattgaatctcgacgaa ctgacagctgacgatattgataccgaagcggcactctttggcgatggattaggtctggac tcaatcgacgccctggagctggggctggcggtgaaaaacgagtatggcgtggtcctctca gcagagagcgaagaaatgcgccagcacttcttctccgtcgccacgctggcatcgttcatt cacgcgcaacgtgcctga

DBGET integrated database retrieval system