KEGG   Corynebacterium ihumii: CIHUM_08880
Entry
CIHUM_08880       CDS       T09115                                 
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
  KO
K06891  ATP-dependent Clp protease adaptor protein ClpS
Organism
cihu  Corynebacterium ihumii
Brite
KEGG Orthology (KO) [BR:cihu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    CIHUM_08880
SSDB
Motif
Pfam: ClpS
Other DBs
NCBI-ProteinID: WCZ35180
UniProt: A0ABY7UES2
LinkDB
Position
complement(1821599..1821943)
AA seq 114 aa
MFSSADFPAASRAQRMGSPLATPELDEALDVDVATSENLPWLCIVWDDPVNLMSYVTYVF
QTVLGYDRKRATELMMQVHTEGKAVVSSGEKDKVETDVKKLHTAGLWATMQQAG
NT seq 345 nt   +upstreamnt  +downstreamnt
atgttttcctcagccgattttcctgcggccagccgtgcgcagcgcatgggttcgccgctg
gcaaccccggagttggacgaggcccttgacgtggacgtggccacgagcgaaaacctgccg
tggctgtgcatcgtgtgggacgacccagtgaacctgatgagctacgtcacctacgtgttc
cagaccgtgctggggtatgaccgcaagcgcgccacggagctgatgatgcaggtccacacc
gagggcaaggccgtggtgtcctcgggcgagaaggacaaggtggaaaccgacgtgaagaag
ctgcacaccgcgggcctgtgggccacgatgcagcaggcagggtag

DBGET integrated database retrieval system