Citromicrobium sp. JL477: WG74_04905 Help Entry WG74_04905        CDS       T04089                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism cij  Citromicrobium sp. JL477 Pathway cij01100   Metabolic pathways cij01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cij00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WG74_04905    00074 Mycolic acid biosynthesis     WG74_04905   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WG74_04905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ALG62221 LinkDB All DBs Position 962492..962737 Genome browser AA seq 81 aa AA seqDB search MTREDVYAKLEPIFRELFDQYEGPITDELTANDVEQWDSLGHVQLVVALEQECGVRCAPQ EVTGLPDLGALVDLFAAKTQA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaccagggaagacgtttacgcaaagctcgaaccgatctttcgggagctgttcgatcag tacgaagggccgatcaccgacgagctgacggccaatgatgtcgaacagtgggacagcctt ggccatgtgcagctggtcgtcgcgctggagcaggaatgcggcgtgcgctgcgctccgcaa gaggtcaccggactgcccgatctgggcgcgctggtcgatctcttcgccgccaagacccag gcctga

DBGET integrated database retrieval system