Citromicrobium sp. JL477: WG74_11110 Help Entry WG74_11110        CDS       T04089                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cij  Citromicrobium sp. JL477 Pathway cij01100   Metabolic pathways cij01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cij00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WG74_11110    00074 Mycolic acid biosynthesis     WG74_11110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WG74_11110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding WGG Motif Other DBs NCBI-ProteinID:  ALG61317 LinkDB All DBs Position 2291358..2291663 Genome browser AA seq 101 aa AA seqDB search MTAQTSAPADPTGPARSKIDETLRAILRDVLGLSDERAAELTPDSGLFGHLPELDSQAVA DLLTEMEDRFDIIIEDDEVDGDHLETYGGLLALAEAKTASN NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaccgcccagacttcagcgcctgcggacccgaccgggcccgcccgcagcaagatcgac gagaccctgcgcgcaatcctgcgcgacgtactcggcctgtcggacgaacgcgccgccgaa ctgacgcccgatagcggcctgttcggccatctgcccgaactcgacagccaggcggtcgcc gacctgctgaccgagatggaagaccggttcgacattatcatcgaggatgacgaggtcgat ggcgaccatctggaaacctatggcgggctgctcgcccttgccgaggccaagaccgccagc aactga

DBGET integrated database retrieval system