Chryseobacterium indoltheticum: EG358_00100 Help Entry EG358_00100       CDS       T06757                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cil  Chryseobacterium indoltheticum Pathway cil01100   Metabolic pathways cil01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cil00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EG358_00100    00074 Mycolic acid biosynthesis     EG358_00100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EG358_00100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding AlphaC_N2 Motif Other DBs NCBI-ProteinID:  AZA72253 UniProt:  A0A381F5G5 LinkDB All DBs Position 18125..18382 Genome browser AA seq 85 aa AA seqDB search MEDLKLELKNKIIEVLNLEDVAVEEIKDTDPLFGGGLGLDSIDALELIVLLDKEYGIKLA DPKKGKEIFESIEVMAKYIQENRTK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggaagatttaaaattagaattaaaaaacaaaataatagaagttcttaatcttgaagac gttgcagtagaagaaatcaaagatacagaccctctttttgggggcggtcttggattagat tctatcgacgctcttgagcttatcgtacttcttgacaaagaatacggaataaaattggca gacccaaagaaaggaaaagaaattttcgagtctatcgaggttatggcaaaatatatccaa gaaaacagaacaaaataa

DBGET integrated database retrieval system