Carya illinoinensis (pecan): 122278042 Help Entry 122278042         CDS       T08745                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism cill  Carya illinoinensis (pecan) Pathway cill03010   Ribosome cill04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cill00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     122278042   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122278042  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:cill03011]     122278042    04121 Ubiquitin system [BR:cill04121]     122278042 Ribosome [BR:cill03011]  Ribosomal proteins   Eukaryotes    Large subunit     122278042   Archaea     122278042 Ubiquitin system [BR:cill04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    122278042 SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Ubiquitin_2 DUF2604 Ubiquitin_5 Plexin_RBD OTU1_UBXL UBL_UBAC1 TBK1_ULD Rad60-SLD_2 Motif Other DBs NCBI-GeneID:  122278042 NCBI-ProteinID:  XP_042944043 LinkDB All DBs Position 10 Genome browser AA seq 79 aa AA seqDB search DKDAFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIVAGKQLEYGRTLADY NIQKESTLYLVLRLRGGII NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gataaagatgcattcgtgaaaaccttaactgggaagaccatcaccctcgaggtcgaaagc agcgacacaattgataatgttaaggctaagatccaagacaaggaaggaattcctccggat cagcagcgtttgatagtcgcgggaaagcagctggaatatggccgtaccctagctgactat aacattcagaaagagtcgacgctgtatcttgtattgagacttcgtggtgggatcatatag

DBGET integrated database retrieval system