Carya illinoinensis (pecan): 122282045 Help Entry 122282045         CDS       T08745                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cill  Carya illinoinensis (pecan) Pathway cill04145   Phagosome cill04148   Efferocytosis cill04517   IgSF CAM signaling cill04518   Integrin signaling cill04620   Toll-like receptor signaling pathway cill05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cill00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     122282045    04518 Integrin signaling     122282045  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     122282045    04148 Efferocytosis     122282045  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     122282045  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     122282045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cill04131]     122282045   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cill04147]     122282045    04031 GTP-binding proteins [BR:cill04031]     122282045 Membrane trafficking [BR:cill04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122282045  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     122282045   Macropinocytosis    Ras GTPases     122282045  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     122282045 Exosome [BR:cill04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    122282045   Exosomal proteins of other body fluids (saliva and urine)    122282045   Exosomal proteins of colorectal cancer cells    122282045   Exosomal proteins of bladder cancer cells    122282045 GTP-binding proteins [BR:cill04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122282045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Sua5_C GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  122282045 NCBI-ProteinID:  XP_042949898 LinkDB All DBs Position 11:5194208..5199256 Genome browser AA seq 210 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVIVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENILKKWIPELHHYAPGAPVVLVGT KSDLREDKHYLADHPGLMPVTTAQGEELRNQIGATYYIECSSKTQQNVKAVFDAAIKVVI KPQQKQKEKNKPSRGCLLNLFRGRSLVCLK NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagcgcctctaggttcattaaatgtgtgacagtgggagatggggctgtaggg aagacatgcatgcttatttgctatacaagtaacaaattccctactgattatatacccact gtttttgataacttcagtgcaaatgtgatagttgaaggcaccactgtcaacttaggcctc tgggacacagctgggcaagaggactacaatagattaaggccattgagctacagaggggca gatgtctttgtcttagctttctccttagttagtcgtgcaagctatgaaaatatactgaaa aagtggatccctgaacttcatcattatgcccctggagctcccgtggtgctggttggcacc aaatcggatcttcgcgaggataagcactatttggcagatcatcctggattgatgcctgtg acaactgcacagggtgaggaactccgtaatcagatcggtgctacatattatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgcaatcaaggtggttatc aagccacagcagaagcaaaaagagaagaacaagccaagtcgtggatgcctattaaatctc tttcgtgggaggagtcttgtgtgtctcaaatga

DBGET integrated database retrieval system