Carya illinoinensis (pecan): 122298534 Help Entry 122298534         CDS       T08745                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism cill  Carya illinoinensis (pecan) Pathway cill04016   MAPK signaling pathway - plant cill04070   Phosphatidylinositol signaling system cill04075   Plant hormone signal transduction cill04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:cill00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     122298534    04070 Phosphatidylinositol signaling system     122298534    04075 Plant hormone signal transduction     122298534  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     122298534  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:cill01009]     122298534   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cill04131]     122298534    03036 Chromosome and associated proteins [BR:cill03036]     122298534   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cill04147]     122298534 Protein phosphatases and associated proteins [BR:cill01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122298534 Membrane trafficking [BR:cill04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122298534 Chromosome and associated proteins [BR:cill03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122298534 Exosome [BR:cill04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122298534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 AIF-1 EF-hand_9 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 DUF5580_M EFhand_Ca_insen EF-hand_11 Caleosin SPEF2_C Dockerin_1 SurA_N_3 FCaBP_EF-hand SurA_N_2 MecA_N Mu-like_Pro YtzH DUF2267 PA_Ig-like Fe_hyd_lg_C DUF6279 Motif Other DBs NCBI-GeneID:  122298534 NCBI-ProteinID:  XP_042964259 LinkDB All DBs Position 16:26818338..26822201 Genome browser AA seq 149 aa AA seqDB search MAEQLTEEQIAEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMISEVDADQ NGTIDFAEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGYISAAELRHVMTNLGEKLTDE EVDEMIREADTDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggagcaactcacggaggagcagatcgctgagttcaaagaagctttcagcctcttc gataaggatggcgatggctgcattacaacaaaagagttgggaacagtcatgagatctttg gggcaaaatcctactgaagctgaactgcaggatatgatcagtgaagttgatgctgaccaa aatggcacaattgatttcgctgagtttctaaatttgatggcacggaaaatgaaggatact gattctgaggaagaactcaaagaggctttcaaggtgttcgataaggatcagaatggctat atttctgctgcagagctccgacatgtaatgacgaatcttggagaaaagctgacagatgaa gaagtggatgagatgatccgcgaagcagatacagacggcgatggtcaggtgaactatgag gaatttgtgaggatgatgcttgctaagtga

DBGET integrated database retrieval system