Carya illinoinensis (pecan): 122303718 Help Entry 122303718         CDS       T08745                                  Name (RefSeq) sm-like protein LSM5   KO K12624   U6 snRNA-associated Sm-like protein LSm5 Organism cill  Carya illinoinensis (pecan) Pathway cill03018   RNA degradation cill03040   Spliceosome Brite KEGG Orthology (KO) [BR:cill00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     122303718   09123 Folding, sorting and degradation    03018 RNA degradation     122303718  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:cill03019]     122303718    03041 Spliceosome [BR:cill03041]     122303718 Messenger RNA biogenesis [BR:cill03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      122303718   mRNA degradation factors    5'-3' decay     Lsm complex      122303718 Spliceosome [BR:cill03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     122303718 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM DUF7452 Ntox4 Motif Other DBs NCBI-GeneID:  122303718 NCBI-ProteinID:  XP_042971559 LinkDB All DBs Position 3:20424058..20428250 Genome browser AA seq 88 aa AA seqDB search MAANNPSQLLPSELIDRCIGSKIWVIMKGDKELVGTLRGFDVYVNMVLEDVTEYEITSEG RRITKLDQILLNGNNIAILVPGGSPDPE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggccgctaacaatccttcgcagctgcttccgtcagaactaattgataggtgcattggg tcaaagatatgggtgataatgaagggggacaaggagctcgttggtactctcaggggcttc gacgtctacgtcaatatggtcctcgaagacgtcacagagtatgagatcacttctgaaggg agacggataacaaagcttgatcagattttactaaatggaaacaacattgccattctcgtg cctggtggttcgcctgatccagaatga

DBGET integrated database retrieval system