Carya illinoinensis (pecan): 122310807 Help Entry 122310807         CDS       T08745                                  Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism cill  Carya illinoinensis (pecan) Pathway cill03030   DNA replication cill03410   Base excision repair cill03420   Nucleotide excision repair cill03430   Mismatch repair cill03440   Homologous recombination Brite KEGG Orthology (KO) [BR:cill00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     122310807    03410 Base excision repair     122310807    03420 Nucleotide excision repair     122310807    03430 Mismatch repair     122310807    03440 Homologous recombination     122310807  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:cill03032]     122310807    03400 DNA repair and recombination proteins [BR:cill03400]     122310807 DNA replication proteins [BR:cill03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     122310807 DNA repair and recombination proteins [BR:cill03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       122310807    MMR (mismatch excision repair)     DNA polymerase delta complex      122310807 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  122310807 NCBI-ProteinID:  XP_042980887 LinkDB All DBs Position 5:complement(39943004..39943894) Genome browser AA seq 124 aa AA seqDB search MAARSENMKGFYRQRKKSGVTKKPLQPSSSSNKSPKHSPTFGSDVTHAPALLSHGSPDLK DEYDESEEVLRQFDLNMAYGPCLGMTRQARWERARRLGLNPPYEIERLLKAGKVEPQCLW DGRV NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggcagcgaggtcagagaacatgaagggattctacagacagaggaagaagagcggcgtc acgaagaagcctcttcaaccttcttcttcaagcaacaaatcgcccaaacactctccgacc ttcggctccgatgtcactcacgcccccgctctcctttcccacggctcccctgacctcaaa gatgagtatgatgagagtgaggaggtgttgcggcaattcgacttgaacatggcgtacgga ccttgcctcgggatgaccagacaggctcgttgggagcgtgctcgtcgtctgggtttgaac cctccctacgaaatcgagcgccttttgaaggccggtaaagttgagccccagtgcttgtgg gatggccgtgtttag

DBGET integrated database retrieval system