Carya illinoinensis (pecan): 122311590 Help Entry 122311590         CDS       T08745                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism cill  Carya illinoinensis (pecan) Pathway cill03083   Polycomb repressive complex cill04120   Ubiquitin mediated proteolysis cill04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:cill00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     122311590    04120 Ubiquitin mediated proteolysis     122311590   09126 Chromosome    03083 Polycomb repressive complex     122311590  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cill04131]     122311590    04121 Ubiquitin system [BR:cill04121]     122311590    03036 Chromosome and associated proteins [BR:cill03036]     122311590 Membrane trafficking [BR:cill04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     122311590 Ubiquitin system [BR:cill04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      122311590    Cul7 complex      122311590 Chromosome and associated proteins [BR:cill03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      122311590   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      122311590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ CUE Motif Other DBs NCBI-GeneID:  122311590 NCBI-ProteinID:  XP_042982127 LinkDB All DBs Position 5:4222226..4223032 Genome browser AA seq 152 aa AA seqDB search MSSSSSKMITLISSDGVAFEVNEAVAHASQTIKQVIEDTCTDDGIPVPNVTSKILAKVLE YCKKHVEPAISDGDLKGWDAEFVEVDQATLFGLILAADYLNIKSLMELTCQTVADMIKGK TPEDIRKTFYIKNDFSPEEEEEVRQENRWAFD NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcgtcgtcaaagatgatcaccctgataagctccgatggcgtggcctttgag gtcaacgaggccgtggctcacgcatcccagaccattaagcaagtgatcgaggacacttgc accgacgacggcatcccggtccccaacgtgacgagcaagatcttggccaaggtcctcgag tactgcaagaagcacgtcgagccagccatctccgacggtgatctcaagggctgggacgcc gagttcgtcgaggttgaccaggccaccctattcggtctcatcctggctgcagactacttg aacatcaagagccttatggagctgacatgccaaacagtggcagacatgatcaagggaaag accccagaggatatccgcaagaccttttacatcaagaatgacttttccccagaggaagaa gaggaggttcgtcaggagaaccggtgggcatttgactga

DBGET integrated database retrieval system