| Entry |
|
|---|
| Symbol |
GNG13
|
|---|
| Name |
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
|
|---|
| KO |
| K04547 | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13 |
|
|---|
| Organism |
cimi Cebus imitator (Panamanian white-faced capuchin)
|
|---|
| Pathway |
| cimi04723 | Retrograde endocannabinoid signaling |
| cimi05167 | Kaposi sarcoma-associated herpesvirus infection |
| cimi05170 | Human immunodeficiency virus 1 infection |
|
|---|
| Brite |
KEGG Orthology (KO) [BR:cimi00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
108290889 (GNG13)
04371 Apelin signaling pathway
108290889 (GNG13)
04151 PI3K-Akt signaling pathway
108290889 (GNG13)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
108290889 (GNG13)
04081 Hormone signaling
108290889 (GNG13)
09150 Organismal Systems
09151 Immune system
04062 Chemokine signaling pathway
108290889 (GNG13)
09152 Endocrine system
04926 Relaxin signaling pathway
108290889 (GNG13)
09156 Nervous system
04724 Glutamatergic synapse
108290889 (GNG13)
04727 GABAergic synapse
108290889 (GNG13)
04725 Cholinergic synapse
108290889 (GNG13)
04728 Dopaminergic synapse
108290889 (GNG13)
04726 Serotonergic synapse
108290889 (GNG13)
04723 Retrograde endocannabinoid signaling
108290889 (GNG13)
09157 Sensory system
04740 Olfactory transduction
108290889 (GNG13)
04742 Taste transduction
108290889 (GNG13)
09159 Environmental adaptation
04713 Circadian entrainment
108290889 (GNG13)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
108290889 (GNG13)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
108290889 (GNG13)
05163 Human cytomegalovirus infection
108290889 (GNG13)
05167 Kaposi sarcoma-associated herpesvirus infection
108290889 (GNG13)
09165 Substance dependence
05032 Morphine addiction
108290889 (GNG13)
05034 Alcoholism
108290889 (GNG13)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04031 GTP-binding proteins [BR:cimi04031]
108290889 (GNG13)
GTP-binding proteins [BR:cimi04031]
Heterotrimeric G-proteins
Gamma Subunits
Gamma [OT]
108290889 (GNG13)
|
|---|
| SSDB |
|
|---|
| Motif |
|
|---|
| Other DBs |
|
|---|
| LinkDB |
|
|---|
| Position |
Unknown
|
|---|
| AA seq |
67 aa
MEEWDVPQMKKEVESLKYQLSYQRETASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCTIL |
|---|
| NT seq |
204 nt +upstreamnt +downstreamnt
atggaggagtgggacgtgccgcagatgaaaaaggaggtggagagcctcaagtatcagctg
tcctaccagcgagagacggcctccaagaccatccccgagctgctgaagtggattgaggat
gggatccccaaagaccccttcctgaaccccgacctgatgaaaaacaacccgtgggtggag
aagggcaagtgcaccatcctgtga |
|---|
