KEGG   Cebus imitator (Panamanian white-faced capuchin): 108296753
Entry
108296753         CDS       T08783                                 
Name
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
cimi  Cebus imitator (Panamanian white-faced capuchin)
Pathway
cimi04014  Ras signaling pathway
cimi04015  Rap1 signaling pathway
cimi04022  cGMP-PKG signaling pathway
cimi04024  cAMP signaling pathway
cimi04062  Chemokine signaling pathway
cimi04071  Sphingolipid signaling pathway
cimi04072  Phospholipase D signaling pathway
cimi04081  Hormone signaling
cimi04144  Endocytosis
cimi04150  mTOR signaling pathway
cimi04270  Vascular smooth muscle contraction
cimi04310  Wnt signaling pathway
cimi04350  TGF-beta signaling pathway
cimi04360  Axon guidance
cimi04510  Focal adhesion
cimi04520  Adherens junction
cimi04530  Tight junction
cimi04611  Platelet activation
cimi04621  NOD-like receptor signaling pathway
cimi04625  C-type lectin receptor signaling pathway
cimi04660  T cell receptor signaling pathway
cimi04670  Leukocyte transendothelial migration
cimi04722  Neurotrophin signaling pathway
cimi04810  Regulation of actin cytoskeleton
cimi04921  Oxytocin signaling pathway
cimi04928  Parathyroid hormone synthesis, secretion and action
cimi04972  Pancreatic secretion
cimi05100  Bacterial invasion of epithelial cells
cimi05132  Salmonella infection
cimi05133  Pertussis
cimi05135  Yersinia infection
cimi05152  Tuberculosis
cimi05163  Human cytomegalovirus infection
cimi05200  Pathways in cancer
cimi05203  Viral carcinogenesis
cimi05205  Proteoglycans in cancer
cimi05206  MicroRNAs in cancer
cimi05210  Colorectal cancer
cimi05417  Lipid and atherosclerosis
cimi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cimi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    108296753
   04015 Rap1 signaling pathway
    108296753
   04310 Wnt signaling pathway
    108296753
   04350 TGF-beta signaling pathway
    108296753
   04072 Phospholipase D signaling pathway
    108296753
   04071 Sphingolipid signaling pathway
    108296753
   04024 cAMP signaling pathway
    108296753
   04022 cGMP-PKG signaling pathway
    108296753
   04150 mTOR signaling pathway
    108296753
  09133 Signaling molecules and interaction
   04081 Hormone signaling
    108296753
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108296753
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    108296753
   04660 T cell receptor signaling pathway
    108296753
   04670 Leukocyte transendothelial migration
    108296753
   04062 Chemokine signaling pathway
    108296753
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    108296753
   04928 Parathyroid hormone synthesis, secretion and action
    108296753
  09154 Digestive system
   04972 Pancreatic secretion
    108296753
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108296753
  09158 Development and regeneration
   04360 Axon guidance
    108296753
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108296753
   05206 MicroRNAs in cancer
    108296753
   05205 Proteoglycans in cancer
    108296753
   05203 Viral carcinogenesis
    108296753
  09162 Cancer: specific types
   05210 Colorectal cancer
    108296753
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    108296753
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    108296753
   05133 Pertussis
    108296753
   05152 Tuberculosis
    108296753
   05100 Bacterial invasion of epithelial cells
    108296753
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108296753
   05418 Fluid shear stress and atherosclerosis
    108296753
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cimi04131]
    108296753
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cimi04147]
    108296753
   04031 GTP-binding proteins [BR:cimi04031]
    108296753
Membrane trafficking [BR:cimi04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    108296753
Exosome [BR:cimi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108296753
  Exosomal proteins of other body fluids (saliva and urine)
   108296753
  Exosomal proteins of colorectal cancer cells
   108296753
  Exosomal proteins of bladder cancer cells
   108296753
GTP-binding proteins [BR:cimi04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    108296753
SSDB
Motif
Pfam: Ras Roc GTP_EFTU VASP_tetra
Other DBs
NCBI-GeneID: 108296753
NCBI-ProteinID: XP_017374824
LinkDB
Position
Unknown
AA seq 112 aa
MCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKP
EEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtgtttttccatcgacagtcctgatagtttagaaaacatcccagaaaagtggaccccg
gaagtcaagcatttctgtcccaacgtgcccatcatcctggttgggaataagaaggatctt
cggaatgatgagcacacaaggcgggagctagccaagatgaagcaggaacctgtgaaacct
gaagaaggcagagatatggcaaacaggattggcgcttttgggtacatggagtgttcagca
aagaccaaagatggagtgagagaggtttttgaaatggctacgagagctgctctgcaagct
agacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system