Entry |
|
Symbol |
GNAI2
|
Name |
(RefSeq) guanine nucleotide-binding protein G(i) subunit alpha-2
|
KO |
K04630 | guanine nucleotide-binding protein G(i) subunit alpha |
|
Organism |
cimi Cebus imitator (Panamanian white-faced capuchin)
|
Pathway |
cimi04261 | Adrenergic signaling in cardiomyocytes |
cimi04670 | Leukocyte transendothelial migration |
cimi04723 | Retrograde endocannabinoid signaling |
cimi04914 | Progesterone-mediated oocyte maturation |
cimi04923 | Regulation of lipolysis in adipocytes |
cimi04928 | Parathyroid hormone synthesis, secretion and action |
cimi04935 | Growth hormone synthesis, secretion and action |
cimi05170 | Human immunodeficiency virus 1 infection |
cimi05207 | Chemical carcinogenesis - receptor activation |
|
Brite |
KEGG Orthology (KO) [BR:cimi00001]
09130 Environmental Information Processing
09132 Signal transduction
04015 Rap1 signaling pathway
108304747 (GNAI2)
04371 Apelin signaling pathway
108304747 (GNAI2)
04071 Sphingolipid signaling pathway
108304747 (GNAI2)
04024 cAMP signaling pathway
108304747 (GNAI2)
04022 cGMP-PKG signaling pathway
108304747 (GNAI2)
09133 Signaling molecules and interaction
04082 Neuroactive ligand signaling
108304747 (GNAI2)
04081 Hormone signaling
108304747 (GNAI2)
09140 Cellular Processes
09144 Cellular community - eukaryotes
04540 Gap junction
108304747 (GNAI2)
09150 Organismal Systems
09151 Immune system
04611 Platelet activation
108304747 (GNAI2)
04670 Leukocyte transendothelial migration
108304747 (GNAI2)
04062 Chemokine signaling pathway
108304747 (GNAI2)
09152 Endocrine system
04923 Regulation of lipolysis in adipocytes
108304747 (GNAI2)
04915 Estrogen signaling pathway
108304747 (GNAI2)
04914 Progesterone-mediated oocyte maturation
108304747 (GNAI2)
04921 Oxytocin signaling pathway
108304747 (GNAI2)
04926 Relaxin signaling pathway
108304747 (GNAI2)
04935 Growth hormone synthesis, secretion and action
108304747 (GNAI2)
04928 Parathyroid hormone synthesis, secretion and action
108304747 (GNAI2)
04916 Melanogenesis
108304747 (GNAI2)
04924 Renin secretion
108304747 (GNAI2)
09153 Circulatory system
04261 Adrenergic signaling in cardiomyocytes
108304747 (GNAI2)
09154 Digestive system
04971 Gastric acid secretion
108304747 (GNAI2)
09156 Nervous system
04724 Glutamatergic synapse
108304747 (GNAI2)
04727 GABAergic synapse
108304747 (GNAI2)
04725 Cholinergic synapse
108304747 (GNAI2)
04728 Dopaminergic synapse
108304747 (GNAI2)
04726 Serotonergic synapse
108304747 (GNAI2)
04730 Long-term depression
108304747 (GNAI2)
04723 Retrograde endocannabinoid signaling
108304747 (GNAI2)
09158 Development and regeneration
04360 Axon guidance
108304747 (GNAI2)
09159 Environmental adaptation
04713 Circadian entrainment
108304747 (GNAI2)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
108304747 (GNAI2)
05207 Chemical carcinogenesis - receptor activation
108304747 (GNAI2)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
108304747 (GNAI2)
05163 Human cytomegalovirus infection
108304747 (GNAI2)
09171 Infectious disease: bacterial
05133 Pertussis
108304747 (GNAI2)
09174 Infectious disease: parasitic
05145 Toxoplasmosis
108304747 (GNAI2)
05142 Chagas disease
108304747 (GNAI2)
09164 Neurodegenerative disease
05012 Parkinson disease
108304747 (GNAI2)
09165 Substance dependence
05030 Cocaine addiction
108304747 (GNAI2)
05032 Morphine addiction
108304747 (GNAI2)
05034 Alcoholism
108304747 (GNAI2)
09167 Endocrine and metabolic disease
04934 Cushing syndrome
108304747 (GNAI2)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:cimi04147]
108304747 (GNAI2)
04031 GTP-binding proteins [BR:cimi04031]
108304747 (GNAI2)
Exosome [BR:cimi04147]
Exosomal proteins
Proteins found in most exosomes
108304747 (GNAI2)
GTP-binding proteins [BR:cimi04031]
Heterotrimeric G-proteins
Alpha Subunits
Alpha type 1 (Gi/o) [OT]
108304747 (GNAI2)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
Unknown
|
AA seq |
256 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYVSRRRPRALAGDERLLPPGRKDIGA
PQARSPPQFLGPFLLPQPARADDTENRILRPSQERLGEDSQRFSAPGPASPEPSNLRSPI
LLSPPMGSCSCEAQDP |
NT seq |
771 nt +upstreamnt +downstreamnt
atggggtgcaccgtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaggacggcgagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggacggc
tactccgaggaggaatgccggcagtaccgggcggttgtctacagcaacaccatccagtcc
atcatggccattgtcaaggccatgggcaacctgcagatcgactttgccgacccctccaga
gcggacgatgccaggcagctgtttgcactgtcctgcactgctgaggagcagggtgtgctc
cctgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctcgagggaataccagctcaacgactcagctgcctatgtctcgcggcgtcgg
ccccgggcactggcaggagatgagaggctgctgccgcccggtcggaaggacatcggcgcc
ccccaagcccggtccccgccccagttcctcgggcctttcctgctgccccagcctgcgagg
gccgacgacacggagaacaggattctgcgcccaagccaggagcggctgggtgaggacagc
cagagattcagcgcccctggccctgcatccccagagccctccaacctaagaagccccatc
cttctgtctccacccatgggcagctgcagctgtgaggcccaggacccttag |