KEGG   Cebus imitator (Panamanian white-faced capuchin): 108307873
Entry
108307873         CDS       T08783                                 
Symbol
RAC1
Name
(RefSeq) ras-related C3 botulinum toxin substrate 1
  KO
K04392  Ras-related C3 botulinum toxin substrate 1
Organism
cimi  Cebus imitator (Panamanian white-faced capuchin)
Pathway
cimi04010  MAPK signaling pathway
cimi04014  Ras signaling pathway
cimi04015  Rap1 signaling pathway
cimi04024  cAMP signaling pathway
cimi04062  Chemokine signaling pathway
cimi04071  Sphingolipid signaling pathway
cimi04145  Phagosome
cimi04148  Efferocytosis
cimi04151  PI3K-Akt signaling pathway
cimi04310  Wnt signaling pathway
cimi04360  Axon guidance
cimi04370  VEGF signaling pathway
cimi04380  Osteoclast differentiation
cimi04510  Focal adhesion
cimi04520  Adherens junction
cimi04530  Tight junction
cimi04613  Neutrophil extracellular trap formation
cimi04620  Toll-like receptor signaling pathway
cimi04650  Natural killer cell mediated cytotoxicity
cimi04662  B cell receptor signaling pathway
cimi04664  Fc epsilon RI signaling pathway
cimi04666  Fc gamma R-mediated phagocytosis
cimi04670  Leukocyte transendothelial migration
cimi04722  Neurotrophin signaling pathway
cimi04810  Regulation of actin cytoskeleton
cimi04932  Non-alcoholic fatty liver disease
cimi04933  AGE-RAGE signaling pathway in diabetic complications
cimi04972  Pancreatic secretion
cimi05014  Amyotrophic lateral sclerosis
cimi05020  Prion disease
cimi05022  Pathways of neurodegeneration - multiple diseases
cimi05100  Bacterial invasion of epithelial cells
cimi05132  Salmonella infection
cimi05135  Yersinia infection
cimi05163  Human cytomegalovirus infection
cimi05167  Kaposi sarcoma-associated herpesvirus infection
cimi05169  Epstein-Barr virus infection
cimi05170  Human immunodeficiency virus 1 infection
cimi05200  Pathways in cancer
cimi05203  Viral carcinogenesis
cimi05205  Proteoglycans in cancer
cimi05208  Chemical carcinogenesis - reactive oxygen species
cimi05210  Colorectal cancer
cimi05211  Renal cell carcinoma
cimi05212  Pancreatic cancer
cimi05231  Choline metabolism in cancer
cimi05415  Diabetic cardiomyopathy
cimi05416  Viral myocarditis
cimi05417  Lipid and atherosclerosis
cimi05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cimi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108307873 (RAC1)
   04014 Ras signaling pathway
    108307873 (RAC1)
   04015 Rap1 signaling pathway
    108307873 (RAC1)
   04310 Wnt signaling pathway
    108307873 (RAC1)
   04370 VEGF signaling pathway
    108307873 (RAC1)
   04071 Sphingolipid signaling pathway
    108307873 (RAC1)
   04024 cAMP signaling pathway
    108307873 (RAC1)
   04151 PI3K-Akt signaling pathway
    108307873 (RAC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    108307873 (RAC1)
   04148 Efferocytosis
    108307873 (RAC1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108307873 (RAC1)
   04520 Adherens junction
    108307873 (RAC1)
   04530 Tight junction
    108307873 (RAC1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108307873 (RAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    108307873 (RAC1)
   04620 Toll-like receptor signaling pathway
    108307873 (RAC1)
   04650 Natural killer cell mediated cytotoxicity
    108307873 (RAC1)
   04662 B cell receptor signaling pathway
    108307873 (RAC1)
   04664 Fc epsilon RI signaling pathway
    108307873 (RAC1)
   04666 Fc gamma R-mediated phagocytosis
    108307873 (RAC1)
   04670 Leukocyte transendothelial migration
    108307873 (RAC1)
   04062 Chemokine signaling pathway
    108307873 (RAC1)
  09154 Digestive system
   04972 Pancreatic secretion
    108307873 (RAC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    108307873 (RAC1)
  09158 Development and regeneration
   04360 Axon guidance
    108307873 (RAC1)
   04380 Osteoclast differentiation
    108307873 (RAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108307873 (RAC1)
   05205 Proteoglycans in cancer
    108307873 (RAC1)
   05208 Chemical carcinogenesis - reactive oxygen species
    108307873 (RAC1)
   05203 Viral carcinogenesis
    108307873 (RAC1)
   05231 Choline metabolism in cancer
    108307873 (RAC1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    108307873 (RAC1)
   05212 Pancreatic cancer
    108307873 (RAC1)
   05211 Renal cell carcinoma
    108307873 (RAC1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108307873 (RAC1)
   05163 Human cytomegalovirus infection
    108307873 (RAC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    108307873 (RAC1)
   05169 Epstein-Barr virus infection
    108307873 (RAC1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108307873 (RAC1)
   05135 Yersinia infection
    108307873 (RAC1)
   05100 Bacterial invasion of epithelial cells
    108307873 (RAC1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    108307873 (RAC1)
   05020 Prion disease
    108307873 (RAC1)
   05022 Pathways of neurodegeneration - multiple diseases
    108307873 (RAC1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    108307873 (RAC1)
   05418 Fluid shear stress and atherosclerosis
    108307873 (RAC1)
   05415 Diabetic cardiomyopathy
    108307873 (RAC1)
   05416 Viral myocarditis
    108307873 (RAC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108307873 (RAC1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    108307873 (RAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cimi04131]
    108307873 (RAC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cimi04147]
    108307873 (RAC1)
   04031 GTP-binding proteins [BR:cimi04031]
    108307873 (RAC1)
Membrane trafficking [BR:cimi04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    108307873 (RAC1)
 Endocytosis
  Lipid raft mediated endocytosis
   Arf6-dependent endocytosis
    108307873 (RAC1)
  Macropinocytosis
   Ras GTPases
    108307873 (RAC1)
 Others
  NADPH oxidases (Nox) and associated proteins
   Nox associated proteins
    108307873 (RAC1)
Exosome [BR:cimi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108307873 (RAC1)
  Exosomal proteins of other body fluids (saliva and urine)
   108307873 (RAC1)
  Exosomal proteins of colorectal cancer cells
   108307873 (RAC1)
  Exosomal proteins of bladder cancer cells
   108307873 (RAC1)
GTP-binding proteins [BR:cimi04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    108307873 (RAC1)
SSDB
Motif
Pfam: Ras Roc CagD
Other DBs
NCBI-GeneID: 108307873
NCBI-ProteinID: XP_037596327
Ensembl: ENSCCAG00000018116
LinkDB
Position
Unknown
AA seq 178 aa
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFEIETWVGETYGKDITSRGKDKPI
ADVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKL
TPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgtaggtaaaacttgcctactg
atcagttacacaaccaatgcatttcctggagaatatatccctactgtctttgaaattgaa
acttgggttggagaaacgtacggtaaggatataacctcccggggcaaagacaagccgatt
gccgatgtgttcttaatttgcttttcccttgtgagtcctgcatcatttgaaaatgtccgc
gcaaagtggtatcctgaggtgcggcaccactgtcccaacactcccatcatcctagtggga
actaaacttgatcttagggatgataaagacacgatcgagaaactgaaggagaagaagctg
actcccatcacctatccacagggtctagccatggctaaggagattggtgctgtaaaatac
ctggagtgctcggcgctcacacagcgaggcctcaagacagtgtttgacgaagcgatccga
gcagtcctctgcccacctcccgtgaagaagaggaagaggaaatgcctcctgctgtaa

DBGET integrated database retrieval system