Ciona intestinalis (yellow sea squirt): 100180468 Help Entry 100180468         CDS       T01056                                  Name (RefSeq) c-Myc-binding protein   KO K25550   c-Myc-binding protein Organism cin  Ciona intestinalis (yellow sea squirt) Brite KEGG Orthology (KO) [BR:cin00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cin03037]     100180468 Cilium and associated proteins [BR:cin03037]  Motile cilia and associated proteins   Sperm associated proteins    100180468 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF7518 TSC22 Cnn_1N GOLGA2L5 bZIP_1 ZapB TACC_C DivIC bZIP_2 IFP_35_N 3-PAP Motif Other DBs NCBI-GeneID:  100180468 NCBI-ProteinID:  XP_002127905 Ensembl:  ENSCING00000004732 UniProt:  F6PWR0 LinkDB All DBs Position 12:5263582..5268158 Genome browser AA seq 104 aa AA seqDB search MTSYRAADSKREEFRKYLEKAGVIDALTKVLVNLYEEPEKPNNALEFLNHHLSGDGPETP DVEALKVDVIELKAKVSQLTDENIELKTRLEKYEPSVAQDDTAE NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgacttcatatagagccgctgattcaaaacgtgaggagttccgaaaatatttggaaaaa gccggcgtgattgatgcattgactaaagtgttggtgaatctgtatgaagaaccagaaaaa ccaaataatgctttggagttcttaaaccaccatctgagtggagacggacctgaaacaccg gatgttgaagctttgaaggtagatgtgattgaactgaaggcaaaggtgtcgcaacttaca gatgaaaatattgaactgaagaccaggcttgagaaatacgagccttcagttgcacaggat gacacagcggagtaa

DBGET integrated database retrieval system