Ciona intestinalis (yellow sea squirt): 108949744 Help Entry 108949744         CDS       T01056                                  Name (RefSeq) ras-related protein Rac1-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04145   Phagosome cin04148   Efferocytosis cin04310   Wnt signaling pathway cin04620   Toll-like receptor signaling pathway cin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     108949744  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     108949744    04148 Efferocytosis     108949744  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108949744  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     108949744  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cin04131]     108949744   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     108949744    04031 GTP-binding proteins [BR:cin04031]     108949744 Membrane trafficking [BR:cin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     108949744  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     108949744   Macropinocytosis    Ras GTPases     108949744  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     108949744 Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108949744   Exosomal proteins of other body fluids (saliva and urine)    108949744   Exosomal proteins of colorectal cancer cells    108949744   Exosomal proteins of bladder cancer cells    108949744 GTP-binding proteins [BR:cin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     108949744 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Motif Other DBs NCBI-GeneID:  108949744 NCBI-ProteinID:  XP_018668724 LinkDB All DBs Position 9:4160456..4162325 Genome browser AA seq 202 aa AA seqDB search MLIRRHALQISMEAIKCVVVGDGAVGKTCLLIRCITNAFPGVNVPTVFENYSVKVVVDGR MMNLGLYDTAGMDDYDRLRLLSYPQTDVFLICYSLVCHSSLENIWWKWFPEISHHAPGTA IVLVGTKCDLREDPETVKVLAKRNISPVTTKQGLQMAKKINAVQFLECSALTQKGVKAVF DEAICAALSSTKQAAKTSCQLY NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atgcttataagacgacacgccctacaaatatcaatggaggcgatcaagtgtgttgtggtt ggagatggagctgttggtaaaacctgtttgctgatccgctgtataaccaatgctttccct ggagtaaatgttcccactgtgtttgaaaactactccgttaaagtcgtggtagatggccga atgatgaacctaggattgtacgatacagcagggatggacgattatgacagactccggctt ctctcgtacccacagacggatgtttttctcatctgctactcactggtttgtcacagctct cttgaaaatatttggtggaagtggtttcctgaaatttcccatcatgccccgggaactgcg attgttttagtggggaccaagtgtgatttacgagaagacccggaaaccgtgaaagttttg gccaaaagaaacatttctcctgtcacgaccaaacaaggtttacaaatggcaaaaaaaatt aacgcagttcagtttttggaatgctctgctttgacacaaaagggcgttaaggctgtgttt gacgaagccatttgtgcagctttatcttcaacaaaacaggcagcaaagacgtcttgccaa ctttattaa

DBGET integrated database retrieval system