Ciona intestinalis (yellow sea squirt): 445685 Help Entry 445685            CDS       T01056                                  Symbol r27a Name (RefSeq) r27a protein   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin03010   Ribosome cin04120   Ubiquitin mediated proteolysis cin04137   Mitophagy - animal cin04140   Autophagy - animal Brite KEGG Orthology (KO) [BR:cin00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     445685 (r27a)   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     445685 (r27a)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     445685 (r27a)    04137 Mitophagy - animal     445685 (r27a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:cin03011]     445685 (r27a)    04121 Ubiquitin system [BR:cin04121]     445685 (r27a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     445685 (r27a) Ribosome [BR:cin03011]  Ribosomal proteins   Eukaryotes    Small subunit     445685 (r27a)   Archaea     445685 (r27a) Ubiquitin system [BR:cin04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    445685 (r27a) Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    445685 (r27a)   Exosomal proteins of colorectal cancer cells    445685 (r27a) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_S27 Rad60-SLD Ubiquitin_2 Rad60-SLD_2 DUF2604 Ubiquitin_5 Dsc3_N IBR HATPase_c UBL_UBAC1 Motif Other DBs NCBI-GeneID:  445685 NCBI-ProteinID:  NP_001027675 Ensembl:  ENSCING00000005834 UniProt:  Q8I7E0 LinkDB All DBs Position 10:828228..830025 Genome browser AA seq 155 aa AA seqDB search MQIFXKTLTGKTITLEVEASDSIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGGKKRKKKTYTTPKKIKHKRVKVKLATLKYYKVDENGKISRLRRE CPNTECGAGVFMASHFDRQYCGKCALTYVFKPENQ NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgcagatcttcgncaaaacccttacgggcaaaaccatcacccttgaggttgaagcatcg gactccattgacaatgtgaaagcaaagattcaggataaggaaggaattcctcctgatcaa caaagattgatcttcgctggcaagcaacttgaagatggacgaactttgagtgattacaac atccagaaagaatccacccttcaccttgtgcttagattgagaggaggtggtaagaagaga aagaagaagacttacaccactccaaagaaaatcaagcataagcgtgtcaaagtcaagctt gcaactcttaaatactacaaggttgatgaaaatggcaagatctcccgtttgagacgtgaa tgtcccaacactgaatgtggtgctggagttttcatggcttcccactttgatcgtcaatat tgcggcaaatgtgccctcacatacgtgttcaaacctgagaaccagtaa

DBGET integrated database retrieval system