Ciona intestinalis (yellow sea squirt): 445701 Help Entry 445701            CDS       T01056                                  Symbol cdc42 Name (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04144   Endocytosis cin04517   IgSF CAM signaling cin04518   Integrin signaling cin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     445701 (cdc42)    04518 Integrin signaling     445701 (cdc42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     445701 (cdc42)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     445701 (cdc42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cin04131]     445701 (cdc42)    03036 Chromosome and associated proteins [BR:cin03036]     445701 (cdc42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     445701 (cdc42)    04031 GTP-binding proteins [BR:cin04031]     445701 (cdc42) Membrane trafficking [BR:cin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     445701 (cdc42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     445701 (cdc42)   Macropinocytosis    Ras GTPases     445701 (cdc42) Chromosome and associated proteins [BR:cin03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     445701 (cdc42) Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of microglial cells    445701 (cdc42)   Exosomal proteins of breast milk    445701 (cdc42) GTP-binding proteins [BR:cin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     445701 (cdc42) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  445701 NCBI-ProteinID:  NP_001027691 Ensembl:  ENSCING00000000822 UniProt:  Q7YT81 LinkDB All DBs Position Unknown AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPQEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSYENIKEKWVPEITHHCPKTPFLLVGTQVDLR DDAATIEKLSKNKQKAITQDMGDKLARELKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKRRRRCQVL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcaaaccataaaatgtgtggttgttggtgatggtgctgttggtaaaacctgccttctt atctcatacacaactaataagtttcctcaagagtatgtcccgactgtgtttgacaactat gcagttacagtaatgattggtggagaaccatataccttgggattatttgatacagcaggc caggaagattatgacagattacgacccctaagctacccccaaactgatgtcttcttagtt tgcttttcggttgtttcaccatcatcatacgaaaatataaaagaaaagtgggtgccagaa atcactcaccattgtccaaagactccattcttgctggttggtacacaagttgatttaagg gacgatgctgcaactatagaaaagttatctaaaaataaacaaaaagcaattactcaagat atgggtgataaacttgcaagggaattaaaagctgtaaaatatgttgaatgttcagctctg actcagaaaggattaaagaatgtatttgatgaagccatattagctgctttggaacctcct gaaccgaagcgtcgtcgacgttgtcaagtcttgtga

DBGET integrated database retrieval system