Ciona intestinalis (yellow sea squirt): 445702 Help Entry 445702            CDS       T01056                                  Name (RefSeq) Rac1 protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04145   Phagosome cin04148   Efferocytosis cin04310   Wnt signaling pathway cin04620   Toll-like receptor signaling pathway cin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     445702  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     445702    04148 Efferocytosis     445702  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     445702  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     445702  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cin04131]     445702   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     445702    04031 GTP-binding proteins [BR:cin04031]     445702 Membrane trafficking [BR:cin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     445702  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     445702   Macropinocytosis    Ras GTPases     445702  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     445702 Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    445702   Exosomal proteins of other body fluids (saliva and urine)    445702   Exosomal proteins of colorectal cancer cells    445702   Exosomal proteins of bladder cancer cells    445702 GTP-binding proteins [BR:cin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     445702 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  445702 NCBI-ProteinID:  NP_001027692 Ensembl:  ENSCING00000002350 UniProt:  Q7YT79 LinkDB All DBs Position 9:4139017..4154930 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPVNLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVAHHCPDTPVILVGTKLDLR DDQETIQKLKEKKLAPILYPQGLQMAKEVNAVKYLECSALTQKGLKTVFDEAIRAVLCPE QKPKKKKPCELL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaggcgatcaagtgtgttgtggttggagatggagctgttggtaaaacctgtttgctg atcagctacacaaccaatgctttccctggagaatatattcccactgtgtttgataactac tctgccaatgtcatggtagatggccgccctgtcaacttgggattatgggatacagcaggg caggaggattacgacagacttcggcctctctcctacccacaaacggacgtttttctgatc tgtttctcactcgtgtcaccagcctcattcgaaaacgtgcgcgcaaagtggtatccagaa gtcgcacaccactgtccagatacaccggtcattctcgtgggaacaaaacttgatttacgt gacgaccaggaaaccatccaaaagctgaaagaaaagaaacttgccccaatcctctaccca caagggttgcagatggcgaaagaagtgaacgccgtaaagtacctggagtgctcggctctc acccaaaaaggcctgaaaaccgttttcgacgaggcgatccgcgccgtcctgtgccctgag caaaagccgaagaaaaagaagccctgcgagcttttgtga

DBGET integrated database retrieval system