Ciona intestinalis (yellow sea squirt): 445704 Help Entry 445704            CDS       T01056                                  Name (RefSeq) TC10 protein   KO K04393   cell division control protein 42 Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04144   Endocytosis cin04517   IgSF CAM signaling cin04518   Integrin signaling cin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     445704    04518 Integrin signaling     445704  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     445704  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     445704  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cin04131]     445704    03036 Chromosome and associated proteins [BR:cin03036]     445704   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     445704    04031 GTP-binding proteins [BR:cin04031]     445704 Membrane trafficking [BR:cin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     445704  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     445704   Macropinocytosis    Ras GTPases     445704 Chromosome and associated proteins [BR:cin03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     445704 Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of microglial cells    445704   Exosomal proteins of breast milk    445704 GTP-binding proteins [BR:cin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     445704 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Motif Other DBs NCBI-GeneID:  445704 NCBI-ProteinID:  NP_001027693 Ensembl:  ENSCING00000009009 UniProt:  Q7YT70 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MASMLRCVVVGDGAVGKTSMLISYTKGGFPDEYVPTILDQYAATITVGGTPYVLELIDTA GQEDYDRLRPLSYNKADVFLVCYSVVVPSSFTNIKETWIPELKQHSTKVPYILVGTQTDL RDDPRVLQELHKKKQKPVNVESGQRRAAKLGAAAYKECSAVTMNGIKDVFDEAIHTVLYP EEKSSEKKNCTIS NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctagcatgttaaggtgtgtagtggtaggagacggcgcagtgggtaagaccagtatg cttatcagttacacaaaagggggtttcccagacgaatatgttccaacgatacttgatcag tatgcggcaacgattactgtgggcggtacaccatatgtgttggaactcatagatacagcg ggtcaagaggattatgacagattaagaccattgtcctacaacaaagccgacgttttcctt gtttgttactctgttgtcgtgccttcttcgtttacaaacatcaaagaaacttggatacca gagttaaaacaacactcaacaaaggtgccctatattttggttggaacgcaaaccgatctt cgggacgacccaagagttttacaggaactccacaaaaagaaacaaaaacctgttaatgtt gaaagtgggcaacgtcgcgcggcgaagttgggggccgctgcttacaaagaatgctcggca gttacgatgaatggaattaaagatgtttttgacgaagcgatacacactgtgttgtaccca gaggaaaaatctagcgagaaaaagaattgtacaatatcttaa

DBGET integrated database retrieval system