Ciona intestinalis (yellow sea squirt): 448954 Help Entry 448954            CDS       T01056                                  Symbol rac2 Name (RefSeq) Rac2 protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04145   Phagosome cin04148   Efferocytosis cin04310   Wnt signaling pathway cin04620   Toll-like receptor signaling pathway cin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     448954 (rac2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     448954 (rac2)    04148 Efferocytosis     448954 (rac2)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     448954 (rac2)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     448954 (rac2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cin04131]     448954 (rac2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     448954 (rac2)    04031 GTP-binding proteins [BR:cin04031]     448954 (rac2) Membrane trafficking [BR:cin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     448954 (rac2)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     448954 (rac2)   Macropinocytosis    Ras GTPases     448954 (rac2)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     448954 (rac2) Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    448954 (rac2)   Exosomal proteins of other body fluids (saliva and urine)    448954 (rac2)   Exosomal proteins of colorectal cancer cells    448954 (rac2)   Exosomal proteins of bladder cancer cells    448954 (rac2) GTP-binding proteins [BR:cin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     448954 (rac2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  448954 NCBI-ProteinID:  NP_001027787 Ensembl:  ENSCING00000002330 UniProt:  Q7YT78 LinkDB All DBs Position 9:4164553..4166252 Genome browser AA seq 192 aa AA seqDB search MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGRPVNLGLWDTAG QEDYDRLRPLSYPQTDVFLICFSVASPASYENVRAKWHPEVAHHCPETPVLLVGTKLDLR DDADTVNKLAEKKLSTITTTQGLQMAKELGAVKYQECSALTQKGLKNVFDEAIRAVLNPT RRVVRTKNCEIL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcaagcgataaagtgcgttgtggttggagatggagctgttggtaaaacctgtttgctg atcagctacacaactaacgctttccctggagaatatattcccactgtgtttgataactac tctgccaatgtcatggtagatggccgccctgtcaacttgggattatgggatacagcagga caggaggattatgacagactccgacctctctcctacccacaaaccgatgtttttctcatt tgtttctctgtggcttctcccgcttcctacgaaaacgtgcgcgcaaagtggcacccggag gtcgcacaccactgcccggaaacgcccgtacttctcgtgggaacaaaacttgatttacgt gacgatgcggacactgtgaacaagctagctgagaaaaagctctccaccattactactacc caaggtttacaaatggcgaaggaactgggggcggttaaataccaagagtgctctgctctg acgcaaaaggggctgaaaaatgttttcgacgaagcgattcgggcggttcttaacccaaca agaagagtcgtccgaacgaagaactgcgaaattctatga

DBGET integrated database retrieval system