Ciona intestinalis (yellow sea squirt): 448958 Help Entry 448958            CDS       T01056                                  Name (RefSeq) Rac5 protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04145   Phagosome cin04148   Efferocytosis cin04310   Wnt signaling pathway cin04620   Toll-like receptor signaling pathway cin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     448958  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     448958    04148 Efferocytosis     448958  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     448958  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     448958  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cin04131]     448958   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     448958    04031 GTP-binding proteins [BR:cin04031]     448958 Membrane trafficking [BR:cin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     448958  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     448958   Macropinocytosis    Ras GTPases     448958  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     448958 Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    448958   Exosomal proteins of other body fluids (saliva and urine)    448958   Exosomal proteins of colorectal cancer cells    448958   Exosomal proteins of bladder cancer cells    448958 GTP-binding proteins [BR:cin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     448958 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU PduV-EutP Motif Other DBs NCBI-GeneID:  448958 NCBI-ProteinID:  NP_001027789 Ensembl:  ENSCING00000002345 UniProt:  Q7YT74 LinkDB All DBs Position 9:4155939..4157964 Genome browser AA seq 193 aa AA seqDB search MQSVKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFESYAANVVVDGNPVNIGLWDTAG QEDYDKLRPLSYPQSDVFVMCFSLVNPTSYENIAEKWYPEVHEHCPDIPIVLVGTKLDLR EDPETLKTLGERNLVPVTKTQGLQLAKKVGAKKYFECSALTRENLDELFLEAMRNALKGP DKIVKEKPNCQII NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgcagtccgtgaaatgtgttgtggttggagatggagctgttggtaaaacctgtttgctg atcagctacacaaccaatgctttccctggagaatatattcccactgtgtttgaaagctat gctgcaaatgttgtggtggatgggaacccagtgaacatcggtttatgggacacagctggc caggaagattacgataaacttcgaccgctatcatacccacagtcagatgtctttgtcatg tgcttctcgttggtaaacccaacatcttatgaaaacattgcagaaaaatggtatccggaa gttcatgaacactgtcccgacatccccattgtactcgttgggacaaaactggatttacgt gaagacccagaaacactcaaaacgttgggtgagagaaatcttgttccagttaccaaaacc cagggcctccagttggcgaaaaaagttggggcaaagaaatattttgagtgctcggcgctt actcgtgaaaacttagacgaactctttcttgaagcaatgcgcaatgccctgaaaggaccg gacaaaattgtaaaagagaaaccaaattgtcaaattatctaa

DBGET integrated database retrieval system