Ciona intestinalis (yellow sea squirt): 619233 Help Entry 619233            CDS       T01056                                  Symbol rcl2 Name (RefSeq) Rac and Cdc42-like 2 protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04145   Phagosome cin04148   Efferocytosis cin04310   Wnt signaling pathway cin04620   Toll-like receptor signaling pathway cin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     619233 (rcl2)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     619233 (rcl2)    04148 Efferocytosis     619233 (rcl2)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     619233 (rcl2)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     619233 (rcl2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cin04131]     619233 (rcl2)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     619233 (rcl2)    04031 GTP-binding proteins [BR:cin04031]     619233 (rcl2) Membrane trafficking [BR:cin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     619233 (rcl2)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     619233 (rcl2)   Macropinocytosis    Ras GTPases     619233 (rcl2)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     619233 (rcl2) Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    619233 (rcl2)   Exosomal proteins of other body fluids (saliva and urine)    619233 (rcl2)   Exosomal proteins of colorectal cancer cells    619233 (rcl2)   Exosomal proteins of bladder cancer cells    619233 (rcl2) GTP-binding proteins [BR:cin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     619233 (rcl2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  619233 NCBI-ProteinID:  NP_001335960 Ensembl:  ENSCING00000005573 UniProt:  Q7YT72 LinkDB All DBs Position 9:complement(2298597..2301045) Genome browser AA seq 192 aa AA seqDB search MQPVKIVVVGDGAVGKTCMCITYANGVFPSDYVPTIFDNYAATSTFEGISYNLALWDTAG QEEYDRLRPLSYPRTNVFLLCFSVVSPASFFSISSKWHPEVSHHSPKTPCILIGTKQDLR DDEETVKKLKNTDSAPIRYEQGEALAKQLGAVKYVECSALKKVGVDSVFQDAISAVLNPA KPPKPTKRCVLL NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atgcagccagtcaaaatagtcgtcgttggagacggagctgtcggaaaaacatgtatgtgc attacttatgcaaacggggtatttcctagtgactatgtgcccaccatattcgacaactat gcagcaacaagcacgtttgagggaatttcctataacttagcactctgggacacggcagga caagaagaatatgacaggttgaggccgttgagttacccacgcaccaatgttttcctgtta tgtttctcagtcgtttccccagcttcgtttttcagcatttcttcaaagtggcatcccgaa gtcagtcaccattcacccaaaactccttgtattttaatcggaacaaagcaggatctcaga gatgacgaagaaaccgtaaaaaagctgaagaatactgattcagcgccgattcgatatgaa caaggagaagcgctagcaaagcaactgggagcagtcaaatacgtggagtgctctgcacta aagaaagtaggggtagactctgtattccaagacgctattagtgcagtgttaaaccctgct aaaccacctaaaccaacgaagaggtgcgtgttactgtaa

DBGET integrated database retrieval system