Ciona intestinalis (yellow sea squirt): 619234 Help Entry 619234            CDS       T01056                                  Symbol rcl1 Name (RefSeq) Rac and Cdc42-like 1 protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04145   Phagosome cin04148   Efferocytosis cin04310   Wnt signaling pathway cin04620   Toll-like receptor signaling pathway cin05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     619234 (rcl1)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     619234 (rcl1)    04148 Efferocytosis     619234 (rcl1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     619234 (rcl1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     619234 (rcl1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cin04131]     619234 (rcl1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cin04147]     619234 (rcl1)    04031 GTP-binding proteins [BR:cin04031]     619234 (rcl1) Membrane trafficking [BR:cin04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     619234 (rcl1)  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     619234 (rcl1)   Macropinocytosis    Ras GTPases     619234 (rcl1)  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     619234 (rcl1) Exosome [BR:cin04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    619234 (rcl1)   Exosomal proteins of other body fluids (saliva and urine)    619234 (rcl1)   Exosomal proteins of colorectal cancer cells    619234 (rcl1)   Exosomal proteins of bladder cancer cells    619234 (rcl1) GTP-binding proteins [BR:cin04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     619234 (rcl1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA Motif Other DBs NCBI-GeneID:  619234 NCBI-ProteinID:  NP_001029008 Ensembl:  ENSCING00000014144 UniProt:  Q7YT73 LinkDB All DBs Position 9:2319448..2322712 Genome browser AA seq 194 aa AA seqDB search MQSIKLVVVGDGAVGKTCLLISYTANAFPREYVPTVFENYMANITVNNQQICLSLWDTAG QEDFDRLRPLSYPDTDVFVLCFSIISPTSFENLQHKWLPELREHCPNVPILLVGTKLDLR EDTEILQQLSSKNLKPITPEEGAKMAKDIKAVKYLECSALTQECLSQVFDDAVIAVLNPS HFSSNNDNSCCKIV NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atgcagtctataaaattggtcgtggtgggcgatggtgccgtgggaaaaacgtgtctactt atcagctacacggcgaatgcctttccaagggagtatgttccgaccgtgtttgaaaactac atggcaaatatcacggtcaacaatcagcaaatttgcttaagtctttgggataccgctggt caagaggattttgacaggttgagaccgctttcatatccagacaccgatgtctttgttctc tgcttctcgataatttctccaacctcctttgaaaatctccagcacaaatggttgcccgag ttacgagaacattgtcctaatgtgcccatcctgctagtgggtacgaagcttgacttgaga gaagacaccgaaattctacaacagctttcctcgaaaaatctaaaaccaataacaccagaa gaaggggcgaaaatggcgaaagatattaaagcagttaaatatttagagtgttctgctcta actcaggagtgtctcagccaagtatttgatgacgctgttattgcagtgctaaacccatca cacttttcaagtaacaatgacaacagctgttgtaagatcgtttaa

DBGET integrated database retrieval system