Ciona intestinalis (yellow sea squirt): 723807 Help Entry 723807            CDS       T01056                                  Symbol dynll6 Name (RefSeq) dynein light chain 6   KO K10418   dynein light chain LC8-type Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04517   IgSF CAM signaling cin04814   Motor proteins Brite KEGG Orthology (KO) [BR:cin00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     723807 (dynll6)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     723807 (dynll6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cin03037]     723807 (dynll6)    04812 Cytoskeleton proteins [BR:cin04812]     723807 (dynll6) Cilium and associated proteins [BR:cin03037]  Motile cilia and associated proteins   Dynein arm    723807 (dynll6) Cytoskeleton proteins [BR:cin04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      723807 (dynll6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  723807 NCBI-ProteinID:  NP_001037826 Ensembl:  ENSCING00000023149 UniProt:  Q2PEE1 LinkDB All DBs Position Unknown AA seq 89 aa AA seqDB search MSDRKAVIKNADMAEDMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCICGR NFGSYVTHETKHFIYFYLGQVAVLLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcggaccgtaaagcagtgattaagaatgcggatatggcggaagatatgcagcaagac gctgtcgattgcgctacacaggcactcgagaaatacaacattgagaaagatattgccgct tacatcaaaaaggagtttgacaaaaagtacaacccaacctggcattgtatttgtggcaga aactttggaagttatgtaactcatgaaacgaagcatttcatttatttctaccttggacaa gtagcagtcctgctgtttaaatctggataa

DBGET integrated database retrieval system