Ciona intestinalis (yellow sea squirt): 723807 Help Entry 723807            CDS       T01056                                  Symbol dynll6 Name (RefSeq) dynein light chain 6   KO K10418   dynein light chain LC8-type Organism cin  Ciona intestinalis (yellow sea squirt) Pathway cin04814   Motor proteins Brite KEGG Orthology (KO) [BR:cin00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     723807 (dynll6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cin03037]     723807 (dynll6)    04812 Cytoskeleton proteins [BR:cin04812]     723807 (dynll6) Cilium and associated proteins [BR:cin03037]  Motile cilia and associated proteins   Dynein arm    723807 (dynll6) Cytoskeleton proteins [BR:cin04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      723807 (dynll6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Sigma70_r2 Motif Other DBs NCBI-GeneID:  723807 NCBI-ProteinID:  NP_001037826 Ensembl:  ENSCING00000023149 UniProt:  Q2PEE1 LinkDB All DBs AA seq 89 aa AA seqDB search MSDRKAVIKNADMAEDMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCICGR NFGSYVTHETKHFIYFYLGQVAVLLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcggaccgtaaagcagtgattaagaatgcggatatggcggaagatatgcagcaagac gctgtcgattgcgctacacaggcactcgagaaatacaacattgagaaagatattgccgct tacatcaaaaaggagtttgacaaaaagtacaacccaacctggcattgtatttgtggcaga aactttggaagttatgtaactcatgaaacgaagcatttcatttatttctaccttggacaa gtagcagtcctgctgtttaaatctggataa

DBGET integrated database retrieval system