Candidatus Campylobacter infans: CINF_0047 Help Entry CINF_0047         CDS       T07502                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cinf  Candidatus Campylobacter infans Pathway cinf00998   Biosynthesis of various antibiotics cinf01100   Metabolic pathways cinf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cinf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CINF_0047 (acpP1)    00074 Mycolic acid biosynthesis     CINF_0047 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CINF_0047 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 PqqD Motif Other DBs NCBI-ProteinID:  QLI04600 UniProt:  A0A7H9CEI0 LinkDB All DBs Position 52968..53201 Genome browser AA seq 77 aa AA seqDB search MAVFDDVVDVVVEQLSVPKENVKMESNIIEDLGADSLDVVELVMALEEKFDVEIPDSDAE KLKTIADVVTFVEGLKK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagtttttgatgatgttgtagatgtagttgtagagcaacttagcgttccaaaagaa aatgtaaaaatggaatcaaatattatagaagatttaggtgctgattcgcttgatgtggtt gagcttgtaatggcgcttgaagaaaaattcgatgtagaaatcccagatagcgatgccgaa aaactaaaaactatcgctgatgtagtaactttcgtagaaggtctaaaaaaataa

DBGET integrated database retrieval system